P15RS Antibody (1B8)

Images

 
Western Blot: P15RS Antibody (1B8) [H00055197-M01] - RPRD1A monoclonal antibody (M01), clone 1B8 Analysis of RPRD1A expression in A-431.
Immunohistochemistry-Paraffin: P15RS Antibody (1B8) [H00055197-M01] - Analysis of monoclonal antibody to RPRD1A on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: P15RS Antibody (1B8) [H00055197-M01] - RPRD1A monoclonal antibody (M01), clone 1B8. Analysis of RPRD1A expression in PC-12.
Western Blot: P15RS Antibody (1B8) [H00055197-M01] - RPRD1A monoclonal antibody (M01), clone 1B8. Analysis of RPRD1A expression in NIH/3T3.
Sandwich ELISA: P15RS Antibody (1B8) [H00055197-M01] - Detection limit for recombinant GST tagged RPRD1A is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

P15RS Antibody (1B8) Summary

Immunogen
RPRD1A (NP_060640, 76 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL
Specificity
P15RS - hypothetical protein FLJ10656
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPRD1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for P15RS Antibody (1B8)

  • Cyclin-dependent kinase inhibitor 2B-related protein (p15INK4B-related protein)
  • Cyclin-dependent kinase inhibitor 2B-related protein
  • FLJ10656
  • HsT3101
  • MGC19513
  • p15INK4B-related protein
  • P15RScyclin-dependent kinase 2B-inhibitor-related protein
  • regulation of nuclear pre-mRNA domain containing 1A
  • regulation of nuclear pre-mRNA domain-containing protein 1A

Background

P15RS is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) (CDKN2B; MIM 600431) and may have a role in cell cycle regulation (Liu et al., 2002 [PubMed 12470661]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP3-15267
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-57432
Species: Hu
Applications: ICC/IF, WB
AF953
Species: Hu
Applications: ICC, IHC, IP, KO, Simple Western, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DMP900
Species: Hu
Applications: ELISA
NBP2-45634
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-56292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56359
Species: Hu
Applications: WB
H00055197-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for P15RS Antibody (H00055197-M01) (0)

There are no publications for P15RS Antibody (H00055197-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P15RS Antibody (H00055197-M01) (0)

There are no reviews for P15RS Antibody (H00055197-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P15RS Antibody (H00055197-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P15RS Products

Bioinformatics Tool for P15RS Antibody (H00055197-M01)

Discover related pathways, diseases and genes to P15RS Antibody (H00055197-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P15RS Antibody (H00055197-M01)

Discover more about diseases related to P15RS Antibody (H00055197-M01).
 

Pathways for P15RS Antibody (H00055197-M01)

View related products by pathway.

PTMs for P15RS Antibody (H00055197-M01)

Learn more about PTMs related to P15RS Antibody (H00055197-M01).
 

Research Areas for P15RS Antibody (H00055197-M01)

Find related products by research area.

Blogs on P15RS

There are no specific blogs for P15RS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P15RS Antibody (1B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPRD1A
Entrez
Uniprot