p107 Antibody (1A5)

Images

 
Western Blot: p107 Antibody (1A5) [H00005933-M01] - Analysis of RBL1 expression in transfected 293T cell line by RBL1 monoclonal antibody (M01), clone 1A5.Lane 1: RBL1 transfected lysate (Predicted MW: 111.54 KDa).Lane ...read more
Proximity Ligation Assay: p107 Antibody (1A5) [H00005933-M01] - Analysis of protein-protein interactions between MYBL2 and RBL1. Mahlavu cells were stained with anti-MYBL2 rabbit purified polyclonal 1:1200 and anti-RBL1 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
1A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p107 Antibody (1A5) Summary

Immunogen
RBL1 (AAH32247, 905 a.a. ~ 1014 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKVR
Specificity
RBL1 - retinoblastoma-like 1 (p107)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p107 Antibody (1A5)

  • cellular protein 107,107 kDa retinoblastoma-associated protein
  • cp107
  • p107MGC40006
  • PRB1
  • retinoblastoma-like 1 (p107)
  • retinoblastoma-like protein 1

Background

The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82455
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NBP1-58200
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38206
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-26616
Species: Hu
Applications: IP, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-21374
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00005933-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for p107 Antibody (H00005933-M01) (0)

There are no publications for p107 Antibody (H00005933-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p107 Antibody (H00005933-M01) (0)

There are no reviews for p107 Antibody (H00005933-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p107 Antibody (H00005933-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p107 Products

Bioinformatics Tool for p107 Antibody (H00005933-M01)

Discover related pathways, diseases and genes to p107 Antibody (H00005933-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p107 Antibody (H00005933-M01)

Discover more about diseases related to p107 Antibody (H00005933-M01).
 

Pathways for p107 Antibody (H00005933-M01)

View related products by pathway.

PTMs for p107 Antibody (H00005933-M01)

Learn more about PTMs related to p107 Antibody (H00005933-M01).
 

Research Areas for p107 Antibody (H00005933-M01)

Find related products by research area.

Blogs on p107

There are no specific blogs for p107, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p107 Antibody (1A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBL1
Entrez
OMIM
Uniprot