Recombinant Human Orexin R1/HCRTR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Orexin R1/HCRTR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-425 of Human HCRTR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HCRTR1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Orexin R1/HCRTR1 Protein

  • HCRTR1
  • hypocretin (orexin) receptor 1
  • hypocretin receptor 1
  • Hypocretin receptor type 1
  • hypocretin receptor-1
  • Orexin R1
  • orexin receptor 1
  • orexin receptor type 1
  • orexin receptor-1
  • OrexinR1
  • OX1R
  • ox-1-R
  • ox1-R

Background

HCRTR1, or orexin 1 receptor (OX1R), is a G-protein coupled receptor expressed in the hypothalamus and involved in the regulation of feeding behaviour. HCRTR1 selectively binds the orexin A neuropeptide. It shares 64% identity with HCRTR2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB763
Species: Hu, Mu, Rt
Applications: IHC
H00003062-M01
Species: Hu
Applications: WB, ELISA, RNAi
AF2554
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01) (0)

There are no publications for Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01) (0)

There are no reviews for Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Orexin R1/HCRTR1 Products

Bioinformatics Tool for Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01)

Discover related pathways, diseases and genes to Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01)

Discover more about diseases related to Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01).
 

Pathways for Orexin R1/HCRTR1 Recombinant Protein (H00003061-P01)

View related products by pathway.

Blogs on Orexin R1/HCRTR1

There are no specific blogs for Orexin R1/HCRTR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POMC Antibody
NB100-1533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Orexin R1/HCRTR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HCRTR1
Entrez