Recombinant Human OR6C3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OR6C3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 311 of Human OR6C3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNHTMVTEFVLLGLSDDPDLQIVIFLFLFITYILSVTGNLTIITLTFVDSHLQTPMYFFLRNFSFLEISFTTVCIPRFLGAIITRNKTISYNNCAAQLFFFIFMGVTEFYILTAMSYDRYVAICKPLHYTSIMNRKLCTLLVLCAWLSGFLTIFPPLMLLLQLDYCASNVIDHFACDYFPLLQLSCSDTWLLEVIGFYFALVTLLFTLALVILSYMYIIRTILRIPSASQRKKAFSTCSSHMIVISISYGSCIFMYANPSAKEKASLTKGIAILNTSVAPMLNPFIYTLRNQQVKQAFKNVVHKVVFYANQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
OR6C3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OR6C3 Protein

  • HSA8
  • olfactory receptor 6C3
  • olfactory receptor, family 6, subfamily C, member 3
  • OST709

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP2-05806
Species: Hu
NBP2-13700
Species: Hu
Applications: IHC, IHC-P
NBP2-05805
Species: Hu
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-2693
Species: Dr
Applications: WB, ELISA, ICC/IF, IHC
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
H00054898-P01
Species: Hu
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30865
Species: Hu
Applications: WB, IHC, IHC-P
H00254786-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for OR6C3 Recombinant Protein (H00254786-P01) (0)

There are no publications for OR6C3 Recombinant Protein (H00254786-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR6C3 Recombinant Protein (H00254786-P01) (0)

There are no reviews for OR6C3 Recombinant Protein (H00254786-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR6C3 Recombinant Protein (H00254786-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OR6C3 Products

OR6C3 H00254786-P01

Bioinformatics Tool for OR6C3 Recombinant Protein (H00254786-P01)

Discover related pathways, diseases and genes to OR6C3 Recombinant Protein (H00254786-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR6C3

There are no specific blogs for OR6C3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
OR6C3 RNAi
H00254786-R02-20nmol
Albumin Antibody
NB600-41532
OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OR6C3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OR6C3