ODF3 Recombinant Protein Antigen (NBP2-32628PEP)

Images

 
There are currently no images for ODF3 Protein (NBP2-32628PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ODF3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ODF3.

Source: E.coli

Amino Acid Sequence: EKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPG

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ODF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32628.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ODF3 Recombinant Protein Antigen

  • CT135
  • hSHIPPO
  • outer dense fiber of sperm tails 3
  • outer dense fiber of sperm tails protein 3
  • outer dense fiber protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60018
Species: Hu
Applications: WB
NBP2-38050
Species: Hu
Applications: IHC, IHC-P
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
NBP2-31979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84357
Species: Hu
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-84346
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
H00008361-R01
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu

Publications for ODF3 Protein (NBP2-32628PEP) (0)

There are no publications for ODF3 Protein (NBP2-32628PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODF3 Protein (NBP2-32628PEP) (0)

There are no reviews for ODF3 Protein (NBP2-32628PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for ODF3 Protein (NBP2-32628PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ODF3 Products

Related Products by Gene

Bioinformatics Tool for ODF3 Protein (NBP2-32628PEP)

Discover related pathways, diseases and genes to ODF3 Protein (NBP2-32628PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODF3 Protein (NBP2-32628PEP)

Discover more about diseases related to ODF3 Protein (NBP2-32628PEP).
 

Pathways for ODF3 Protein (NBP2-32628PEP)

View related products by pathway.

Blogs on ODF3

There are no specific blogs for ODF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ODF3 Antibody
NBP1-90614
ODF3 Antibody
NBP1-90614

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ODF3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ODF3