OCTN1/SLC22A4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OCTN1/SLC22A4 Antibody [NBP2-68632] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OCTN1/SLC22A4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLGMTLPETLEQMQKVKWFRSGKKTRDSMETEENPKVLITAF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for OCTN1/SLC22A4 Antibody

  • Ergothioneine transporter
  • ET transporter
  • ETT
  • MGC34546
  • MGC40524
  • OCTN1
  • OCTN1integral membrane transport protein
  • Organic cation/carnitine transporter 1
  • SLC22A4
  • solute carrier family 22 (organic cation/ergothioneine transporter), member 4
  • solute carrier family 22 member 4
  • UT2H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single Cell Western
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-28739
Species: Hu
Applications: WB, IP
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40730
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP2-75734
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA, PAGE
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP2-60542
Species: Hu
AF7895
Species: Hu
Applications: WB, IHC
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP2-67779
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-44873
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PAGE, Flow-CS
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NBP2-68632
Species: Hu
Applications: ICC/IF

Publications for OCTN1/SLC22A4 Antibody (NBP2-68632) (0)

There are no publications for OCTN1/SLC22A4 Antibody (NBP2-68632).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCTN1/SLC22A4 Antibody (NBP2-68632) (0)

There are no reviews for OCTN1/SLC22A4 Antibody (NBP2-68632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OCTN1/SLC22A4 Antibody (NBP2-68632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OCTN1/SLC22A4 Products

Bioinformatics Tool for OCTN1/SLC22A4 Antibody (NBP2-68632)

Discover related pathways, diseases and genes to OCTN1/SLC22A4 Antibody (NBP2-68632). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCTN1/SLC22A4 Antibody (NBP2-68632)

Discover more about diseases related to OCTN1/SLC22A4 Antibody (NBP2-68632).
 

Pathways for OCTN1/SLC22A4 Antibody (NBP2-68632)

View related products by pathway.

PTMs for OCTN1/SLC22A4 Antibody (NBP2-68632)

Learn more about PTMs related to OCTN1/SLC22A4 Antibody (NBP2-68632).

Blogs on OCTN1/SLC22A4

There are no specific blogs for OCTN1/SLC22A4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OCTN1/SLC22A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A4
Novus 100% Guarantee