OCRL Antibody (4A6)

Images

 
Western Blot: OCRL Antibody (4A6) [H00004952-M02] - OCRL monoclonal antibody (M02), clone 4A6 Analysis of OCRL expression in Hela S3 NE.
Immunohistochemistry-Paraffin: OCRL Antibody (4A6) [H00004952-M02] - Analysis of monoclonal antibody to OCRL on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: OCRL Antibody (4A6) [H00004952-M02] - Analysis of OCRL over-expressed 293 cell line, cotransfected with OCRL Validated Chimera RNAi ( Cat # H00004952-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: OCRL Antibody (4A6) [H00004952-M02] - Analysis of OCRL expression in transfected 293T cell line by OCRL monoclonal antibody (M02), clone 4A6.Lane 1: OCRL transfected lysate(103.2 KDa).Lane 2: ...read more
Sandwich ELISA: OCRL Antibody (4A6) [H00004952-M02] - Detection limit for recombinant GST tagged OCRL is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, RNAi
Clone
4A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OCRL Antibody (4A6) Summary

Immunogen
OCRL (NP_000267 146 a.a. - 239 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQT
Specificity
OCRL - oculocerebrorenal syndrome of Lowe
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OCRL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OCRL Antibody (4A6)

  • EC 3.1.3.36
  • INPP5F
  • LOCR
  • Lowe oculocerebrorenal syndrome protein
  • NPHL2
  • OCRL1inositol polyphosphate 5-phosphatase OCRL-1
  • oculocerebrorenal syndrome of Lowe
  • phosphatidylinositol polyphosphate 5-phosphatase

Background

This gene encodes a phosphatase enzyme that is involved in actin polymerization and is found in the trans-Golgi network. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89439
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-69123
Species: Hu, Mu, Rt
Applications: WB
NBP2-49463
Species: Hu
Applications: IHC, IHC-P
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00003636-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57739
Species: Hu
Applications: WB
MAB7075
Species: Hu
Applications: WB
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004952-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi

Publications for OCRL Antibody (H00004952-M02) (0)

There are no publications for OCRL Antibody (H00004952-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCRL Antibody (H00004952-M02) (0)

There are no reviews for OCRL Antibody (H00004952-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCRL Antibody (H00004952-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OCRL Products

Bioinformatics Tool for OCRL Antibody (H00004952-M02)

Discover related pathways, diseases and genes to OCRL Antibody (H00004952-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCRL Antibody (H00004952-M02)

Discover more about diseases related to OCRL Antibody (H00004952-M02).
 

Pathways for OCRL Antibody (H00004952-M02)

View related products by pathway.

PTMs for OCRL Antibody (H00004952-M02)

Learn more about PTMs related to OCRL Antibody (H00004952-M02).
 

Research Areas for OCRL Antibody (H00004952-M02)

Find related products by research area.

Blogs on OCRL

There are no specific blogs for OCRL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OCRL Antibody (4A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol OCRL
Entrez
OMIM
Uniprot