OBCAM/OPCML Antibody - BSA Free

Western Blot: OBCAM/OPCML Antibody [NBP3-09427] - Western blot analysis of OBCAM/OPCML in Rat Liver. Antibody dilution at 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OBCAM/OPCML Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OBCAM/OPCML Antibody - BSA Free (NBP3-09427) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen for Anti-OBCAM/OPCML antibody is: synthetic peptide directed towards the C-terminal of Rat OPCM (NP_446300.1). Peptide sequence EDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNT
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OPCML
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OBCAM/OPCML Antibody - BSA Free

• IgLON family member 1
• IGLON1opioid-binding protein/cell adhesion molecule-like
• OBCAM
• OBCAMopiate binding-cell adhesion molecule
• OPCM
• OPCML
• opioid binding protein/cell adhesion molecule-like preprotein
• opioid binding protein/cell adhesion molecule-like
• Opioid-binding cell adhesion molecule
• opioid-binding protein/cell adhesion molecule

Background

OPCML encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily. The encoded protein is localized in the plasma membrane and may have an accessory role in opioid receptor function. This gene has an ortholog in rat and bovine. The opioid binding-cell adhesion molecule encoded by the rat gene binds opioid alkaloids in the presence of acidic lipids, exhibits selectivity for mu ligands and acts as a GPI-anchored protein. Since the encoded protein is highly conserved in species during evolution, it may have a fundamental role in mammalian systems. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OPCML