O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen

Images

 
There are currently no images for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human O-GlcNAc Transferase p110 subunit.

Source: E. coli

Amino Acid Sequence: LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCY

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OGT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48598.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen

  • EC 2.4.1
  • EC 2.4.1.255
  • FLJ23071
  • HRNT1
  • MGC22921
  • O-GlcNAc transferase p110 subunit
  • O-GlcNAc transferase subunit p110
  • OGlcNAc Transferase
  • O-GlcNAc Transferase
  • O-GLCNAC
  • OGT
  • O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
  • O-linked N-acetylglucosamine transferase 110 kDa subunit
  • UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit
  • uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81244
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB100-68209
Species: Hu
Applications: WB, IP
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2200
Species: Hu
Applications: WB, IP
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NBP2-14977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48598PEP
Species: Hu
Applications: AC

Publications for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP) (0)

There are no publications for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP) (0)

There are no reviews for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP)

Discover related pathways, diseases and genes to O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP)

Discover more about diseases related to O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP).
 

Pathways for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP)

View related products by pathway.

PTMs for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP)

Learn more about PTMs related to O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP).
 

Research Areas for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP2-48598PEP)

Find related products by research area.

Blogs on O-GlcNAc Transferase p110 subunit

There are no specific blogs for O-GlcNAc Transferase p110 subunit, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OGT
Entrez