O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen

Images

 
There are currently no images for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP1-89845PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OGT.

Source: E. coli

Amino Acid Sequence: LYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OGT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89845.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen

  • EC 2.4.1
  • EC 2.4.1.255
  • FLJ23071
  • HRNT1
  • MGC22921
  • O-GlcNAc transferase p110 subunit
  • O-GlcNAc transferase subunit p110
  • OGlcNAc Transferase
  • O-GlcNAc Transferase
  • O-GLCNAC
  • OGT
  • O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
  • O-linked N-acetylglucosamine transferase 110 kDa subunit
  • UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit
  • uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase

Background

Diffusion of metabolites and small non-nuclear molecules as well as active, mediated import of protein and export of protein and RNA through the nuclear envelope occurs through nuclear pore complexes or NPC's. NPC's contain up to 100 different polypeptides which have a combined mass of about 125 megadaltons. The channel available for passive transport through the NPC is about 9-10 nm in diameter while carrier mediated changes in the NPC result in a ~25 nm channel used for larger, actively transported molecules. Of the 100 polypeptides, at least 8 of these are O-linked N-acetylglycosamine-modified in mammalian cells. All of the mammalian O-linked glycoproteins contain multiple copies of phenylalanine, glycine dipeptide repeats dispersed throughout part of their sequence. Studies indicate that the NPC O-linked glycoproteins have a direct role in nuclear protein import.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP2-02056
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, WB
3047-CC
Species: Hu
Applications: BA
DPSG10
Species: Hu
Applications: ELISA
NB100-68209
Species: Hu
Applications: IP, KD, WB
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF2200
Species: Hu
Applications: IP, WB
NBP1-83289
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14977
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP1-89845PEP) (0)

There are no publications for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP1-89845PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP1-89845PEP) (0)

There are no reviews for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP1-89845PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP1-89845PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional O-GlcNAc Transferase p110 subunit Products

Research Areas for O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP1-89845PEP)

Find related products by research area.

Blogs on O-GlcNAc Transferase p110 subunit

There are no specific blogs for O-GlcNAc Transferase p110 subunit, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OGT