NXF3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NXF3 Antibody [NBP1-89471] Staining of human cell line U-251MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: NXF3 Antibody [NBP1-89471] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts, Leydig cells expressed moderate cytoplasmic staining.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NXF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSILELFPKLLCLDGQQSPRATLCGTEAHKRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NXF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NXF3 Protein (NBP1-89471PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NXF3 Antibody

  • nuclear RNA export factor 3
  • TAPL3
  • TAPL-3
  • TAP-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06574
Species: Mu, Rt, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15049
Species: Hu
Applications: WB, ICC/IF
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45674
Species: Hu
Applications: WB, IHC
NBP1-80964
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for NXF3 Antibody (NBP1-89471) (0)

There are no publications for NXF3 Antibody (NBP1-89471).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NXF3 Antibody (NBP1-89471) (0)

There are no reviews for NXF3 Antibody (NBP1-89471). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NXF3 Antibody (NBP1-89471) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NXF3 Products

Bioinformatics Tool for NXF3 Antibody (NBP1-89471)

Discover related pathways, diseases and genes to NXF3 Antibody (NBP1-89471). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NXF3 Antibody (NBP1-89471)

Discover more about diseases related to NXF3 Antibody (NBP1-89471).
 

Pathways for NXF3 Antibody (NBP1-89471)

View related products by pathway.

Blogs on NXF3

There are no specific blogs for NXF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NXF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NXF3