Recombinant Human Nuclear Factor Erythroid Derived 2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Nuclear Factor Erythroid Derived 2 Protein [H00004778-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Nuclear Factor Erythroid Derived 2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 264-373 of Human Nuclear Factor Erythroid Derived 2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LALVRDIRRRGKNKVAAQNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEYALQQAADGTIFLVPRGTKMEATD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NFE2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nuclear Factor Erythroid Derived 2 GST (N-Term) Protein

  • Leucine zipper protein NF-E2
  • NF-E2
  • nuclear factor (erythroid-derived 2), 45kD
  • nuclear factor (erythroid-derived 2), 45kDa
  • Nuclear factor, erythroid-derived 2 45 kDa subunit
  • p45 NF-E2
  • p45
  • transcription factor NF-E2 45 kDa subunit

Background

NFE2 - nuclear factor (erythroid-derived 2), 45kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47492
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3809
Species: Hu, Mu
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-93792
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-67710
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-89125
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready

Publications for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01) (0)

There are no publications for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01) (0)

There are no reviews for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Nuclear Factor Erythroid Derived 2 Products

Bioinformatics Tool for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01)

Discover related pathways, diseases and genes to Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01)

Discover more about diseases related to Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01).
 

Pathways for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01)

View related products by pathway.

PTMs for Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01)

Learn more about PTMs related to Nuclear Factor Erythroid Derived 2 Partial Recombinant Protein (H00004778-Q01).

Blogs on Nuclear Factor Erythroid Derived 2

There are no specific blogs for Nuclear Factor Erythroid Derived 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nuclear Factor Erythroid Derived 2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2