NSUN4 Antibody

Images

 
Western Blot: NSUN4 Antibody [NBP1-82733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: NSUN4 Antibody [NBP1-82733] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NSUN4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAALTLRGVRELLKRVDLATVPRRHRYKKKWAATEPKFPAVRLALQNFDMTYSVQFGDLWPSIRVSLLSEQKYGALVNNFAAWDHVSAKLEQLSAKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSUN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NSUN4 Protein (NBP1-82733PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSUN4 Antibody

  • EC 2.1.1
  • EC 2.1.1.-
  • EC 2.1.1.29
  • MGC22960
  • NOL1/NOP2/Sun domain family 4
  • NOL1/NOP2/Sun domain family member 4
  • NOL1/NOP2/Sun domain family, member 4
  • NOP2/Sun domain family, member 4
  • putative methyltransferase NSUN4
  • RP4-603I14.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92144
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6386
Species: Hu
Applications: WB, IP
NBL1-14964
Species: Hu
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP

Publications for NSUN4 Antibody (NBP1-82733) (0)

There are no publications for NSUN4 Antibody (NBP1-82733).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSUN4 Antibody (NBP1-82733) (0)

There are no reviews for NSUN4 Antibody (NBP1-82733). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NSUN4 Antibody (NBP1-82733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NSUN4 Products

Bioinformatics Tool for NSUN4 Antibody (NBP1-82733)

Discover related pathways, diseases and genes to NSUN4 Antibody (NBP1-82733). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSUN4 Antibody (NBP1-82733)

Discover more about diseases related to NSUN4 Antibody (NBP1-82733).
 

Pathways for NSUN4 Antibody (NBP1-82733)

View related products by pathway.

PTMs for NSUN4 Antibody (NBP1-82733)

Learn more about PTMs related to NSUN4 Antibody (NBP1-82733).

Blogs on NSUN4

There are no specific blogs for NSUN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSUN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSUN4