NSDHL Antibody (6E3)

Images

 
Western Blot: NSDHL Antibody (6E3) [H00050814-M01] - NSDHL monoclonal antibody (M01), clone 6E3. Analysis of NSDHL expression in Raw 264.7.
Western Blot: NSDHL Antibody (6E3) [H00050814-M01] - NSDHL monoclonal antibody (M01), clone 6E3. Analysis of NSDHL expression in PC-12.
Western Blot: NSDHL Antibody (6E3) [H00050814-M01] - NSDHL monoclonal antibody (M01), clone 6E3. Analysis of NSDHL expression in A-431.
Sandwich ELISA: NSDHL Antibody (6E3) [H00050814-M01] - Detection limit for recombinant GST tagged NSDHL is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
6E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NSDHL Antibody (6E3) Summary

Immunogen
NSDHL (NP_057006, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPS
Specificity
NSDHL - NAD(P) dependent steroid dehydrogenase-like
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NSDHL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NSDHL Antibody (6E3)

  • EC 1.1.1.170
  • H105e3
  • member 1
  • NAD(P) dependent steroid dehydrogenase-like
  • SDR31E1
  • sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
  • XAP104

Background

The protein encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-06227
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-01170
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16463
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00001717-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
NBP2-66888
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IP
NBP1-57587
Species: Hu
Applications: WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59443
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32005
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP

Publications for NSDHL Antibody (H00050814-M01) (0)

There are no publications for NSDHL Antibody (H00050814-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSDHL Antibody (H00050814-M01) (0)

There are no reviews for NSDHL Antibody (H00050814-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NSDHL Antibody (H00050814-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NSDHL Products

Bioinformatics Tool for NSDHL Antibody (H00050814-M01)

Discover related pathways, diseases and genes to NSDHL Antibody (H00050814-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSDHL Antibody (H00050814-M01)

Discover more about diseases related to NSDHL Antibody (H00050814-M01).
 

Pathways for NSDHL Antibody (H00050814-M01)

View related products by pathway.

PTMs for NSDHL Antibody (H00050814-M01)

Learn more about PTMs related to NSDHL Antibody (H00050814-M01).

Blogs on NSDHL

There are no specific blogs for NSDHL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSDHL Antibody (6E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NSDHL
Entrez
OMIM
Uniprot