NRAMP2/SLC11A2/DMT1 Antibody [FITC] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human NRAMP2/SLC11A2/DMT1 (NP_001167597.1).
Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLC11A2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody [FITC]
Background
The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for NRAMP2/SLC11A2/DMT1 Antibody (NBP3-35108F) (0)
There are no publications for NRAMP2/SLC11A2/DMT1 Antibody (NBP3-35108F).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NRAMP2/SLC11A2/DMT1 Antibody (NBP3-35108F) (0)
There are no reviews for NRAMP2/SLC11A2/DMT1 Antibody (NBP3-35108F).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NRAMP2/SLC11A2/DMT1 Antibody (NBP3-35108F). (Showing 1 - 1 of 1 FAQ).
-
Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
- We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.
Secondary Antibodies
| |
Isotype Controls
|
Additional NRAMP2/SLC11A2/DMT1 Products
Blogs on NRAMP2/SLC11A2/DMT1