NRAMP2/SLC11A2/DMT1 Antibody (2F7)

Images

 
Sandwich ELISA: NRAMP2/SLC11A2/DMT1 Antibody (2F7) [H00004891-M06] - Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NRAMP2/SLC11A2/DMT1 Antibody (2F7) Summary

Immunogen
SLC11A2 (NP_000608, 1 a.a. - 65 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
Specificity
SLC11A2 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (2F7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC11A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody (2F7)

  • DCT1
  • DCT1NRAMP 2
  • Divalent cation transporter 1
  • Divalent metal transporter 1
  • DMT-1
  • DMT1FLJ37416
  • member 2
  • NRAMP2
  • NRAMP2natural resistance-associated macrophage protein 2
  • SLC11A2
  • solute carrier family 11 (proton-coupled divalent metal ion transporters)

Background

The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-21502
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-914
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85483
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00004891-M06
Species: Hu
Applications: WB, ELISA

Publications for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06) (0)

There are no publications for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06) (0)

There are no reviews for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06). (Showing 1 - 1 of 1 FAQ).

  1. Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
    • We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Secondary Antibodies

 

Isotype Controls

Additional NRAMP2/SLC11A2/DMT1 Products

Bioinformatics Tool for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06)

Discover related pathways, diseases and genes to NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06)

Discover more about diseases related to NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06).
 

Pathways for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06)

View related products by pathway.

PTMs for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06)

Learn more about PTMs related to NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M06).

Blogs on NRAMP2/SLC11A2/DMT1

There are no specific blogs for NRAMP2/SLC11A2/DMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRAMP2/SLC11A2/DMT1 Antibody (2F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC11A2
Entrez
Uniprot