NPHP3 Antibody

Images

 
Immunohistochemistry-Paraffin: NPHP3 Antibody [NBP1-83543] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPHP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEFAHSSIDVEGPFANVNRDDWDIAVASLLQVTPLFSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKS
Specificity
Specificity of human NPHP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPHP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NPHP3 Protein (NBP1-83543PEP)
Publications
Read Publication using NBP1-83543.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%). Reactivity reported in scientific literature (PMID: 23414517)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPHP3 Antibody

  • FLJ30691
  • FLJ36696
  • KIAA2000DKFZp667K242
  • MKS7DKFZp781K1312
  • nephrocystin-3
  • nephronophthisis 3 (adolescent)
  • NPH3MGC78666
  • RHPD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-98647
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-47626
Species: Hu
Applications: ELISA, IHC, IHC-P, PEP-ELISA
AF4208
Species: Rt
Applications: WB
NBP1-82539
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-69080
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-67843
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-78897
Species: Hu
H00009094-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP1-93673
Species: Hu
Applications: IHC, IHC-P
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for NPHP3 Antibody (NBP1-83543)(1)

Reviews for NPHP3 Antibody (NBP1-83543) (0)

There are no reviews for NPHP3 Antibody (NBP1-83543). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NPHP3 Antibody (NBP1-83543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NPHP3 Products

Array NBP1-83543

Bioinformatics Tool for NPHP3 Antibody (NBP1-83543)

Discover related pathways, diseases and genes to NPHP3 Antibody (NBP1-83543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPHP3 Antibody (NBP1-83543)

Discover more about diseases related to NPHP3 Antibody (NBP1-83543).
 

Pathways for NPHP3 Antibody (NBP1-83543)

View related products by pathway.

PTMs for NPHP3 Antibody (NBP1-83543)

Learn more about PTMs related to NPHP3 Antibody (NBP1-83543).

Blogs on NPHP3

There are no specific blogs for NPHP3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPHP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPHP3