NME5 Recombinant Protein Antigen

Images

 
There are currently no images for NME5 Recombinant Protein Antigen (NBP2-58388PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NME5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NME5.

Source: E. coli

Amino Acid Sequence: FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NME5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58388.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NME5 Recombinant Protein Antigen

  • Inhibitor of p53-induced apoptosis-beta
  • IPIA-beta
  • NDK-H 5
  • NDP kinase homolog 5
  • NM23H5
  • nm23-H5
  • non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)
  • nucleoside diphosphate kinase homolog 5
  • radial spoke 23 homolog
  • RSPH23
  • Testis-specific nm23 homolog

Background

NME5, or Nucleoside diphosphate kinase homolog 5, consists of a 212 amino acid isoform that is 24 kDa, and is involved in spermiogenesis. Current disease research is being conducted on the relationship between NME5 and pneumonia. The protein has been linked to several biological processes, including purine metabolism, pyrimidine metabolism, and the pyrimidine ribonucleotide salvage pathway. NME5 has been found to interact with DYDC1, DYDC2, RELA, NFS1, and AK7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP3-41832
Species: Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP2-38904
Species: Hu
Applications: IHC,  IHC-P
NBP1-83482
Species: Hu
Applications: IHC,  IHC-P, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP2-02487
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF5975
Species: Mu
Applications: WB
NBP1-56852
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-20229
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
H00008000-M03
Species: Hu
Applications: ELISA, PA, WB
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32319
Species: Hu
Applications: ICC/IF, WB
NBP2-58388PEP
Species: Hu
Applications: AC

Publications for NME5 Recombinant Protein Antigen (NBP2-58388PEP) (0)

There are no publications for NME5 Recombinant Protein Antigen (NBP2-58388PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NME5 Recombinant Protein Antigen (NBP2-58388PEP) (0)

There are no reviews for NME5 Recombinant Protein Antigen (NBP2-58388PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NME5 Recombinant Protein Antigen (NBP2-58388PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NME5 Products

Research Areas for NME5 Recombinant Protein Antigen (NBP2-58388PEP)

Find related products by research area.

Blogs on NME5

There are no specific blogs for NME5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NME5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NME5