NIRF Antibody - BSA Free

Images

 
Western Blot: NIRF Antibody [NBP2-94538] - Paraffin-embedded mouse liver using NIRF .
Immunocytochemistry/ Immunofluorescence: NIRF Antibody [NBP2-94538] - Analysis of U-2 OS cells using NIRF at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NIRF Antibody [NBP2-94538] - Paraffin-embedded rat Intestine using NIRF .
Immunohistochemistry-Paraffin: NIRF Antibody [NBP2-94538] - Paraffin-embedded human kidney cancer using NIRF .

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NIRF Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 441-622 of human UHRF2 (NP_690856.1). IVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVEPAPWTS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UHRF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NIRF Antibody - BSA Free

  • DKFZp434B0920
  • DKFZp686G0837
  • E3 ubiquitin-protein ligase UHRF2
  • EC 6.3.2
  • EC 6.3.2.-
  • MGC33463
  • NIRFUbiquitin-like-containing PHD and RING finger domains protein 2
  • Np95/ICBP90-like RING finger protein
  • Np95-like RING finger protein
  • Nuclear protein 97
  • Nuclear zinc finger protein Np97
  • RNF107RING finger protein 107
  • Ubiquitin-like PHD and RING finger domain-containing protein 2
  • ubiquitin-like with PHD and ring finger domains 2
  • ubiquitin-like, containing PHD and RING finger domains, 2
  • URF2

Background

NIRF encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NIRF Antibody (NBP2-94538) (0)

There are no publications for NIRF Antibody (NBP2-94538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIRF Antibody (NBP2-94538) (0)

There are no reviews for NIRF Antibody (NBP2-94538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NIRF Antibody (NBP2-94538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIRF Products

Research Areas for NIRF Antibody (NBP2-94538)

Find related products by research area.

Blogs on NIRF

There are no specific blogs for NIRF, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIRF Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol UHRF2