NIR2 Recombinant Protein Antigen

Images

 
There are currently no images for NIR2 Protein (NBP2-34132PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NIR2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PITPNM1.

Source: E.coli

Amino Acid Sequence: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PITPNM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-34132.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NIR2 Recombinant Protein Antigen

  • DRES9NIR-2
  • Drosophila retinal degeneration B homolog
  • FLJ44997
  • membrane-associated phosphatidylinositol transfer protein 1
  • NIR2PITPNM
  • phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2
  • PITPnm 1
  • Rd9
  • RDGB
  • RDGB1
  • RDGBA
  • RDGBA1
  • retinal degeneration B alpha 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80994
Species: Hu
Applications: IHC, IHC-P
NBP2-33894
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19842
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
H00284131-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13742
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31237
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-58286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF6868
Species: Hu
Applications: WB, IHC
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003757-Q01
Species: Hu
NBP2-34132PEP
Species: Hu
Applications: AC

Publications for NIR2 Protein (NBP2-34132PEP) (0)

There are no publications for NIR2 Protein (NBP2-34132PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIR2 Protein (NBP2-34132PEP) (0)

There are no reviews for NIR2 Protein (NBP2-34132PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NIR2 Protein (NBP2-34132PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for NIR2 Protein (NBP2-34132PEP)

Discover related pathways, diseases and genes to NIR2 Protein (NBP2-34132PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIR2 Protein (NBP2-34132PEP)

Discover more about diseases related to NIR2 Protein (NBP2-34132PEP).
 

Pathways for NIR2 Protein (NBP2-34132PEP)

View related products by pathway.

PTMs for NIR2 Protein (NBP2-34132PEP)

Learn more about PTMs related to NIR2 Protein (NBP2-34132PEP).
 

Research Areas for NIR2 Protein (NBP2-34132PEP)

Find related products by research area.

Blogs on NIR2

There are no specific blogs for NIR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NIR2 Antibody
NBP2-34132
VAP-B Antibody
NBP1-89112

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NIR2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PITPNM1