Nicotinic Acetylcholine Receptor epsilon Antibody (1H5)

Images

 
Sandwich ELISA: Nicotinic Acetylcholine Receptor epsilon Antibody (1H5) [H00001145-M02] - Detection limit for recombinant GST tagged CHRNE is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nicotinic Acetylcholine Receptor epsilon Antibody (1H5) Summary

Immunogen
CHRNE (NP_000071, 21 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHRNE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nicotinic Acetylcholine Receptor epsilon Antibody (1H5)

  • acetylcholine receptor subunit epsilon
  • AchR epsilon subunit
  • ACHREFCCMS
  • cholinergic receptor, nicotinic, epsilon polypeptide
  • cholinergic receptor, nicotinic, epsilon
  • CMS1D
  • CMS1E
  • CMS2A
  • SCCMS

Background

Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The achetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57262
Species: Hu
Applications: ICC/IF
640-A3
Species: Mu
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14915
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79952
Species: Hu
Applications: WB
NB120-2804
Species: Hu, Mu, Rt, Am, Ch, Fi
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84478
Species: Hu
Applications: WB, IHC, IHC-P
H00006329-R01
Species: Hu
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt

Publications for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02) (0)

There are no publications for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02) (0)

There are no reviews for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine Receptor epsilon Products

Bioinformatics Tool for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02)

Discover more about diseases related to Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02).
 

Pathways for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02)

View related products by pathway.

PTMs for Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02)

Learn more about PTMs related to Nicotinic Acetylcholine Receptor epsilon Antibody (H00001145-M02).

Blogs on Nicotinic Acetylcholine Receptor epsilon

There are no specific blogs for Nicotinic Acetylcholine Receptor epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine Receptor epsilon Antibody (1H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNE
Uniprot