Nicotinic Acetylcholine Receptor beta Antibody

Images

 
Western Blot: Nicotinic Acetylcholine Receptor beta Antibody [NBP1-84478] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine Receptor beta Antibody [NBP1-84478] - Staining of human liver shows cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nicotinic Acetylcholine Receptor beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nicotinic Acetylcholine Receptor beta Protein (NBP1-84478PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nicotinic Acetylcholine Receptor beta Antibody

  • acetylcholine receptor subunit beta
  • ACHRBSCCMS
  • cholinergic receptor, nicotinic, beta 1 (muscle)
  • cholinergic receptor, nicotinic, beta polypeptide 1 (muscle)
  • CHRNB
  • CMS1D
  • CMS2A
  • FLJ57107

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-57262
Species: Hu
Applications: ICC/IF
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2804
Species: Hu, Mu, Rt, Am, Ch, Fi
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-79952
Species: Hu
Applications: WB
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-33010
Species: Mu
Applications: WB
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-02073
Species: Hu, Mu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-79951
Species: Hu
Applications: WB
NBP1-79948
Species: Hu, Rt
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-69122
Species: Hu
Applications: WB
NBP1-80090
Species: Hu
Applications: WB
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
NBP1-84478
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478) (0)

There are no publications for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478) (0)

There are no reviews for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine Receptor beta Products

Bioinformatics Tool for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478)

Discover more about diseases related to Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478).
 

Pathways for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478)

View related products by pathway.

PTMs for Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478)

Learn more about PTMs related to Nicotinic Acetylcholine Receptor beta Antibody (NBP1-84478).

Blogs on Nicotinic Acetylcholine Receptor beta

There are no specific blogs for Nicotinic Acetylcholine Receptor beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine Receptor beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNB1