Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein [H00001139-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Order Details


    • Catalog Number
      H00001139-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-321 of Human CHRNA7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CHRNA7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Functional
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
61.05 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00001139-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 GST (N-Term) Protein

  • a7 nicotinic acetylcholine receptor
  • alpha 7 neuronal nicotinic acetylcholine receptor
  • alpha-7 nicotinic cholinergic receptor subunit
  • cholinergic receptor, nicotinic, alpha 7
  • cholinergic receptor, nicotinic, alpha polypeptide 7
  • CHRNA7
  • CHRNA7-2
  • NACHRA7
  • neuronal acetylcholine receptor protein, alpha-7 chain
  • neuronal acetylcholine receptor subunit alpha-7
  • Nicotinic Acetylcholine R alpha 7
  • Nicotinic Acetylcholine Ra 7

Background

CHRNA7( AAH37571, 1 a.a. - 322 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61674
Species: Hu
Applications: ELISA, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP3-38474
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-28467
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP2-61677
Species: Hu, Rt
Applications: ELISA, Flow, WB
NBP2-61667
Species: Hu, Rt
Applications: ELISA, WB
NBP2-61743
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
DBD00
Species: Hu
Applications: ELISA
H00001142-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-17138
Species: Hu
Applications: IHC,  IHC-P
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001139-P01
Species: Hu
Applications: WB, ELISA, Func, MA, AP

Publications for Nicotinic Acetylcholine R alpha 7/CHRNA7 Partial Recombinant Protein (H00001139-P01)(3)

Reviews for Nicotinic Acetylcholine R alpha 7/CHRNA7 Partial Recombinant Protein (H00001139-P01) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 7/CHRNA7 Partial Recombinant Protein (H00001139-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 7/CHRNA7 Partial Recombinant Protein (H00001139-P01). (Showing 1 - 2 of 2 FAQs).

  1. I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
    • We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.
  2. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Additional Nicotinic Acetylcholine R alpha 7/CHRNA7 Products

Blogs on Nicotinic Acetylcholine R alpha 7/CHRNA7

There are no specific blogs for Nicotinic Acetylcholine R alpha 7/CHRNA7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA7