Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [Alexa Fluor® 405]

Images

 

Order Details


    • Catalog Number
      NBP3-35614AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [Alexa Fluor® 405] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 23-230 of human Nicotinic Acetylcholine R alpha 7/CHRNA7 (NP_001177384.1).

Sequence:
ASPPSTPPWDPGHIPGASVRPAPGPVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [Alexa Fluor® 405]

  • a7 nicotinic acetylcholine receptor
  • alpha 7 neuronal nicotinic acetylcholine receptor
  • alpha-7 nicotinic cholinergic receptor subunit
  • cholinergic receptor, nicotinic, alpha 7
  • cholinergic receptor, nicotinic, alpha polypeptide 7
  • CHRNA7
  • CHRNA7-2
  • NACHRA7
  • neuronal acetylcholine receptor protein, alpha-7 chain
  • neuronal acetylcholine receptor subunit alpha-7
  • Nicotinic Acetylcholine R alpha 7
  • Nicotinic Acetylcholine Ra 7

Background

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediatefast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits.The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conservedtransmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminalextracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeabilityto calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to,alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation thataffects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene islocated in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomallocation involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event inthis region results in a hybrid containing sequence from this gene and a novel FAM7A gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61674
Species: Hu
Applications: ELISA, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP3-38474
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-28467
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP2-61677
Species: Hu, Rt
Applications: ELISA, Flow, WB
NBP2-61667
Species: Hu, Rt
Applications: ELISA, WB
NBP2-61743
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
DBD00
Species: Hu
Applications: ELISA
H00001142-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-17138
Species: Hu
Applications: IHC,  IHC-P
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35614AF405
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC

Publications for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody (NBP3-35614AF405) (0)

There are no publications for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody (NBP3-35614AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody (NBP3-35614AF405) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody (NBP3-35614AF405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody (NBP3-35614AF405). (Showing 1 - 2 of 2 FAQ).

  1. I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
    • We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.
  2. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine R alpha 7/CHRNA7 Products

Research Areas for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody (NBP3-35614AF405)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 7/CHRNA7

There are no specific blogs for Nicotinic Acetylcholine R alpha 7/CHRNA7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [Alexa Fluor® 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA7