Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human cell line RH-30 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human liver shows no positivity in hepatocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Analysis in human skeletal muscle and cerebral cortex tissues. Corresponding CHRNA1 RNA-seq ...read more
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHF
Specificity
Specificity of human Nicotinic Acetylcholine R alpha 1/CHRNA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P: Retrieval method: HIER pH6
Control Peptide
Nicotinic Acetylcholine R alpha 1/CHRNA1 Recombinant Protein Antigen (NBP2-57262PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

  • acetylcholine receptor subunit alpha
  • ACHRA
  • ACHRD
  • CHNRA
  • cholinergic receptor, nicotinic, alpha 1 (muscle)
  • CHRNA
  • CHRNA1
  • CMS2A
  • FCCMS
  • nAChR alpha 1
  • nAchRa1
  • Nicotinic Acetylcholine R alpha 1
  • Nicotinic Acetylcholine Ra1
  • nicotinic acetylcholine receptor alpha subunit
  • nicotinic cholinergic receptor alpha 1
  • nicotinic, alpha polypeptide 1 (muscle)
  • SCCMS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61674
Species: Hu
Applications: WB, ELISA
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2804
Species: Hu, Mu, Rt, Am, Ch, Fi
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84478
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79952
Species: Hu
Applications: WB
NBP2-61673
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-385
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-79951
Species: Hu
Applications: WB
NBP2-61677
Species: Hu, Rt
Applications: WB, ELISA, Flow
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF640
Species: Mu
Applications: WB, IHC
H00029116-P01
Species: Hu
NBP2-57262
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262) (0)

There are no publications for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Discover more about diseases related to Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262).
 

Pathways for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

View related products by pathway.

PTMs for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Learn more about PTMs related to Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262).
 

Research Areas for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 1/CHRNA1

There are no specific blogs for Nicotinic Acetylcholine R alpha 1/CHRNA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA1