Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Analysis in human skeletal muscle and cerebral cortex tissues. Corresponding CHRNA1 RNA-seq ...read more
Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human cell line RH-30 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Validated by:
       

Orthogonal Strategies

 

Order Details


    • Catalog Number
      NBP2-57262
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHF
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P: Retrieval method: HIER pH6

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

  • acetylcholine receptor subunit alpha
  • ACHRA
  • ACHRD
  • CHNRA
  • cholinergic receptor, nicotinic, alpha 1 (muscle)
  • CHRNA
  • CHRNA1
  • CMS2A
  • FCCMS
  • nAChR alpha 1
  • nAchRa1
  • Nicotinic Acetylcholine R alpha 1
  • Nicotinic Acetylcholine Ra1
  • nicotinic acetylcholine receptor alpha subunit
  • nicotinic cholinergic receptor alpha 1
  • nicotinic, alpha polypeptide 1 (muscle)
  • SCCMS

Background

The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61674
Species: Hu
Applications: ELISA, WB
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-2804
Species: Am, Ch, Fi, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-47613
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-79952
Species: Hu
Applications: WB
NBP2-61673
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NB100-385
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NBP2-26108
Species: Mu
Applications: PEP-ELISA, WB
NBP2-61677
Species: Hu, Rt
Applications: ELISA, Flow, WB
MAB66861
Species: Hu
Applications: ICC, WB
AF640
Species: Mu
Applications: IHC, WB
NBP3-46975
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-57262
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262) (0)

There are no publications for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine R alpha 1/CHRNA1 Products

Research Areas for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 1/CHRNA1

There are no specific blogs for Nicotinic Acetylcholine R alpha 1/CHRNA1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA1