Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody


Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human cell line RH-30 shows localization to plasma membrane. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining in human skeletal muscle and skin tissues using anti-CHRNA1 antibody. Corresponding more
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-57262] - Staining of human skin shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHF
Specificity of human Nicotinic Acetylcholine R alpha 1/CHRNA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nicotinic Acetylcholine R alpha 1/CHRNA1 Recombinant Protein Antigen (NBP2-57262PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

  • acetylcholine receptor subunit alpha
  • cholinergic receptor, nicotinic, alpha 1 (muscle)
  • CHRNA1
  • CMS2A
  • nAChR alpha 1
  • nAchRa1
  • Nicotinic Acetylcholine R alpha 1
  • Nicotinic Acetylcholine Ra1
  • nicotinic acetylcholine receptor alpha subunit
  • nicotinic cholinergic receptor alpha 1
  • nicotinic, alpha polypeptide 1 (muscle)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Am, Ch, Fi
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, ELISA
Species: Hu, Rt
Applications: WB, ELISA, Flow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Species: Hu
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262) (0)

There are no publications for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Discover more about diseases related to Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262).

Pathways for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

View related products by pathway.

PTMs for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Learn more about PTMs related to Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262).

Research Areas for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody (NBP2-57262)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 1/CHRNA1

There are no specific blogs for Nicotinic Acetylcholine R alpha 1/CHRNA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody and receive a gift card or discount.


Gene Symbol CHRNA1