NHSL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NHSL2 Antibody [NBP2-30932] - Staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: NHSL2 Antibody [NBP2-30932] - Staining of human appendix shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NHSL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: STFSTSWKGDAFTYMTPSATSQSNQVNENGKNPSCGNSWVSLNKVPPLVPKEAATLLVARDNPAGCSGSAGYPERLIQQRHMPERPSKI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NHSL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NHSL2 Protein (NBP2-30932PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NHSL2 Antibody

  • NHS-like 2
  • NHS-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-57026
Species: Hu
Applications: ICC/IF
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90025
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NB100-2270
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3075
Species: Hu
Applications: WB, ICC
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13837
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NHSL2 Antibody (NBP2-30932) (0)

There are no publications for NHSL2 Antibody (NBP2-30932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHSL2 Antibody (NBP2-30932) (0)

There are no reviews for NHSL2 Antibody (NBP2-30932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NHSL2 Antibody (NBP2-30932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHSL2 Products

Bioinformatics Tool for NHSL2 Antibody (NBP2-30932)

Discover related pathways, diseases and genes to NHSL2 Antibody (NBP2-30932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHSL2 Antibody (NBP2-30932)

Discover more about diseases related to NHSL2 Antibody (NBP2-30932).
 

Pathways for NHSL2 Antibody (NBP2-30932)

View related products by pathway.

Blogs on NHSL2

There are no specific blogs for NHSL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHSL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NHSL2
Uniprot