![Immunohistochemistry-Paraffin: NHSL2 Antibody [NBP2-30459] - Staining of human appendix shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/NHSL2 Antibody-Immunohistochemistry-Paraffin-NBP2-30459-img0002.jpg "Immunohistochemistry-Paraffin: NHSL2 Antibody [NBP2-30459] - Staining of human appendix shows cytoplasmic positivity in glandular cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TSPMEKFPKSRLSFDLPLTSSPNLDLSGMSISIRSKTKVSRHHSETNFGVKLAQKTNPNQPIMPMVTQSDLRSVRLRSVSKSEPEDD |
| Specificity | Specificity of human NHSL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (93%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NHSL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for NHSL2 Antibody (NBP2-30459)Discover more about diseases related to NHSL2 Antibody (NBP2-30459).
| Pathways for NHSL2 Antibody (NBP2-30459)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: NHS Antibody [NBP1-86329] - Staining of human liver shows strong cytoplasmic positivity( granular pattern) in hepatocytes.](http://images.novusbio.com/fullsize/NHS Antibody-Immunohistochemistry-Paraffin-NBP1-86329-img0002.jpg)
![Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize2/NAP1L1-Antibody-Western-Blot-NBP1-81162-img0006.jpg)
![Immunohistochemistry: NAP1L1 Antibody [NBP1-81162] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/NAP1L1-Antibody-Immunohistochemistry-NBP1-81162-img0007.jpg)
![Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize2/NAP1L1-Antibody-Western-Blot-NBP1-81162-img0005.jpg)
![Western Blot: nef-associated protein 1 Antibody [NBP2-14424] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize2/nef-associated-protein-1-Antibody-Western-Blot-NBP2-14424-img0002.jpg)
![Immunohistochemistry-Paraffin: nef-associated protein 1 Antibody [NBP2-14424] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/nef-associated-protein-1-Antibody-Immunohistochemistry-Paraffin-NBP2-14424-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: NHSL1 Antibody [NBP1-90025] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize2/NHSL1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90025-img0007.jpg)
![Immunohistochemistry-Paraffin: NHSL1 Antibody [NBP1-90025] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/NHSL1-Antibody-Immunohistochemistry-Paraffin-NBP1-90025-img0006.jpg)
![Western Blot: NAP1 Antibody [NBP2-24727] - Western blot analysis of NAP1 in human kidney lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24727 at 0.5 ug/ml.](http://images.novusbio.com/fullsize2/NAP1 Antibody-Western Blot-NBP2-24727-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: SRA1 Antibody [NBP2-47260] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize2/SRA1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47260-img0004.jpg)
![Immunohistochemistry-Paraffin: SRA1 Antibody [NBP2-47260] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/SRA1-Antibody-Immunohistochemistry-Paraffin-NBP2-47260-img0003.jpg)
![Western Blot: CYFIP1 Antibody [NBP2-16060] - Sample (30 ug of whole cell lysate) A: HeLa 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/fullsize2/CYFIP1 Antibody-Western Blot-NBP2-16060-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CYFIP1 Antibody [NBP2-16060] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/CYFIP1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16060-img0004.jpg)
![Immunohistochemistry-Paraffin: CYFIP1 Antibody [NBP2-16060] - Immunohistochemical analysis of paraffin-embedded Hepatoma, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/CYFIP1 Antibody-Immunohistochemistry-Paraffin-NBP2-16060-img0003.jpg)
![Western Blot: NCKAP1 Antibody [NBP1-83269] - Analysis in control (vector only transfected HEK293T lysate) and nCKAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/NCKAP1-Antibody-Western-Blot-NBP1-83269-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: NCKAP1 Antibody [NBP1-83269] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody shown in green.](http://images.novusbio.com/fullsize2/NCKAP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83269-img0006.jpg)
![Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining in human cerebral cortex and skeletal muscle tissues using anti-NCKAP1 antibody. Corresponding NCKAP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/NCKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83269-img0009.jpg)
![Western Blot: NAA25 Antibody [NBP1-88391] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/NAA25-Antibody-Western-Blot-NBP1-88391-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: NAA25 Antibody [NBP1-88391] - Staining of human cell line U-2 OS shows positivity in cytoplasm & the Golgi apparatus.](http://images.novusbio.com/fullsize2/NAA25-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88391-img0005.jpg)
![Immunohistochemistry-Paraffin: NAA25 Antibody [NBP1-88391] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/NAA25-Antibody-Immunohistochemistry-Paraffin-NBP1-88391-img0007.jpg)
![Western Blot: CHERP Antibody [NBP2-13837] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/CHERP Antibody-Western Blot-NBP2-13837-img0002.jpg)
![Immunohistochemistry-Paraffin: CHERP Antibody [NBP2-13837] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal and glial cells.](http://images.novusbio.com/fullsize2/CHERP-Antibody-Immunohistochemistry-Paraffin-NBP2-13837-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: AZI2 Antibody [NBP1-88924] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.](http://images.novusbio.com/fullsize/AZI2 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88924-img0004.jpg)
![Immunohistochemistry-Paraffin: AZI2 Antibody [NBP1-88924] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://images.novusbio.com/fullsize/AZI2 Antibody-Immunohistochemistry-Paraffin-NBP1-88924-img0002.jpg)
![Western Blot: Napsin-A Antibody (TMU-Ad02) [NB110-68133] - Analysis of NAPSA expression in human lung using NB110-68133.](http://images.novusbio.com/fullsize2/Napsin-A-Antibody-(TMU-Ad02)-Western-Blot-NB110-68133-img0009.jpg)
![Immunohistochemistry-Paraffin: Napsin-A Antibody (TMU-Ad02) [NB110-68133] - Analysis of NAPSA on human lung adenocarcinoma using NB110-68133.](http://images.novusbio.com/fullsize2/Napsin-A-Antibody-(TMU-Ad02)-Immunohistochemistry-Paraffin-NB110-68133-img0008.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")