Recombinant Human NHLRC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NHLRC1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 137 - 246 of Human NHLRC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDF

Protein/Peptide Type
Partial Recombinant Protein
Gene
NHLRC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NHLRC1 Protein

  • bA204B7.2
  • E3 ubiquitin-protein ligase NHLRC1
  • EC 6.3.2.-
  • EPM2A
  • EPM2BMGC119264
  • MALIN
  • MGC119262
  • MGC119265
  • NHL repeat containing 1
  • NHL repeat-containing protein 1

Background

The NHLRC1 gene encodes malin, a single subunit E3 ubiquitin (UBB; MIM 191339) ligase, which contains a RING-HC-type zinc finger and 6 NHL domains and is subclassified as a member of the RING-HCa family (Gentry et al., 2005 [PubMed 15930137]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87236
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-82243
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-03092
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-77316
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for NHLRC1 Partial Recombinant Protein (H00378884-Q01) (0)

There are no publications for NHLRC1 Partial Recombinant Protein (H00378884-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHLRC1 Partial Recombinant Protein (H00378884-Q01) (0)

There are no reviews for NHLRC1 Partial Recombinant Protein (H00378884-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHLRC1 Partial Recombinant Protein (H00378884-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NHLRC1 Products

Bioinformatics Tool for NHLRC1 Partial Recombinant Protein (H00378884-Q01)

Discover related pathways, diseases and genes to NHLRC1 Partial Recombinant Protein (H00378884-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHLRC1 Partial Recombinant Protein (H00378884-Q01)

Discover more about diseases related to NHLRC1 Partial Recombinant Protein (H00378884-Q01).
 

Pathways for NHLRC1 Partial Recombinant Protein (H00378884-Q01)

View related products by pathway.

PTMs for NHLRC1 Partial Recombinant Protein (H00378884-Q01)

Learn more about PTMs related to NHLRC1 Partial Recombinant Protein (H00378884-Q01).

Blogs on NHLRC1

There are no specific blogs for NHLRC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FoxC2 Antibody
NB100-1269

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NHLRC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NHLRC1