Recombinant Human NHE6/SLC9A6 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NHE6/SLC9A6 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 602-669 of Human NHE6/SLC9A6

Source: Wheat Germ

Amino Acid Sequence: YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC9A6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
33.22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NHE6/SLC9A6 Protein

  • MRSA
  • NHE6
  • NHE6isoform 6
  • SLC9A6
  • solute carrier family 9 (sodium/hydrogen exchanger), member 6
  • Solute carrier family 9 member 6

Background

SLC9A6 - solute carrier family 9 (sodium/hydrogen exchanger), isoform 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77275
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-67560
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2574
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IHC-Fr (-)
NBP2-50247
Species: Hu
Applications: WB, IHC
NBP2-13391
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1151
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01446
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PA
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01) (0)

There are no publications for NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01) (0)

There are no reviews for NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional NHE6/SLC9A6 Products

Bioinformatics Tool for NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01)

Discover related pathways, diseases and genes to NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01)

Discover more about diseases related to NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01).
 

Pathways for NHE6/SLC9A6 Partial Recombinant Protein (H00010479-Q01)

View related products by pathway.

Blogs on NHE6/SLC9A6

There are no specific blogs for NHE6/SLC9A6, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NHE6/SLC9A6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A6