NFkB p105/p50 Antibody [DyLight 594]

Product Discontinued

NFkB p105/p50 Antibody [DyLight 594] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 41-365 of human NFkB p105/p50 (NP_001158884.1).
  
  Sequence:
  DFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFKB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for NFkB p105/p50 Antibody [DyLight 594]

• DKFZp686C01211
• DNA binding factor KBF1
• DNA-binding factor KBF1
• EBP-1
• KBF1
• NF-kappaB
• NF-kappa-B
• NF-kappabeta
• NFKB-p105
• NFKB-p50
• nuclear factor kappa-B DNA binding subunit
• nuclear factor NF-kappa-B p105 subunit
• nuclear factor NF-kappa-B p50 subunit
• nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151
• p105
• p50

Background

NFkB is a transcription regulator that is activated by various intra and extra cellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Serine 529 is located in a negatively charged region (amino acids 422-540) that is phosphorylated in response to phorbol myristate acetate plus calcium ionophore activation. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFKB1