Neuromedin UR2/NMUR2 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPTALSSEQMSRTNYQSFHFN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NMUR2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Neuromedin UR2/NMUR2 Antibody
Background
Neuromedin U Receptor 2 is a Neuromedin Receptor. NMU2R may mediate the contractile activity of neuromedin U in the uterus. Neuromedin U Receptor 2 has been reported in the central nervous system and in the uterus. ESTs have been isolated from diseased brain and colon carcinoma libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Publications for Neuromedin UR2/NMUR2 Antibody (NBP1-92189) (0)
There are no publications for Neuromedin UR2/NMUR2 Antibody (NBP1-92189).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neuromedin UR2/NMUR2 Antibody (NBP1-92189) (0)
There are no reviews for Neuromedin UR2/NMUR2 Antibody (NBP1-92189).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Neuromedin UR2/NMUR2 Antibody (NBP1-92189) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neuromedin UR2/NMUR2 Products
Research Areas for Neuromedin UR2/NMUR2 Antibody (NBP1-92189)
Find related products by research area.
|
Blogs on Neuromedin UR2/NMUR2