Neuromedin S Overexpression Lysate Summary
| Description |
Neuromedin S Transient Overexpression Lysate Expression Host: HEK293T
Plasmid: RC223176
Accession#: NM_001011717
Protein Tag: C-MYC/DDK
You will receive 1 vial of lysate (100ug), 1 vial of empty vector negative control (100ug), and 1 vial of 2xSDS sample buffer (250ul). Each vial of cell lysate contains 100ug of total protein (at 1 mg/ml). The 2xSDS Sample Buffer consists of 4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromophenol blue, 100mM DTT. |
| Gene |
NMS |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product is intended for use as a positive control in Western Blot. Overexpression of the target protein was confirmed using an antibody to DDK (FLAG) epitope tag ( NBP1-71705) present on the protein construct. Each vial of cell lysate contains 100ug of total protein which should be sufficient for 20-50 reactions. Depending on over-expression level, antibody affinity and detection system, some lysates can go as low as 0.1 ug per load. We recommend starting with 5ug of cell lysate. Add an equal amount of cell lysate and 2X SDS Sample buffer and boil the SDS samples for 10 minutes before loading. |
| Theoretical MW |
3.7 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
RIPA buffer |
Lysate Details for Array
Notes
HEK293T cells in 10-cm dishes were transiently transfected with a non-lipid polymer transfection reagent specially designed and manufactured for large volume DNA transfection. Transfected cells were cultured for 48hrs before collection. The cells were lysed in modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4, and then centrifuged to clarify the lysate. Protein concentration was measured by BCA protein assay kit.
Alternate Names for Neuromedin S Overexpression Lysate
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Lysates are
guaranteed for 6 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: EM, IHC, IHC-Fr, IHC-P, WB
Species: Bt, Bv, Ca, Gp, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: IHC, WB
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Publications for Neuromedin S Lysate (NBP2-11002) (0)
There are no publications for Neuromedin S Lysate (NBP2-11002).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neuromedin S Lysate (NBP2-11002) (0)
There are no reviews for Neuromedin S Lysate (NBP2-11002).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Neuromedin S Lysate (NBP2-11002). (Showing 1 - 1 of 1 FAQ).
-
Could you please let me know NMS antibody cross-reactivity with Neuromedin U? In addition to the query cross-reactivity of Neuromedin S Antibody (NBP1-87515) to Neuromedin U (NMU) whether in the image (imunohistochemistry-Paraffin: Neuromedin S Antibody [NBP1-87515] Immunohistochemical staining of human placenta shows distinct nuclear positivity in trophoblasts), an experiment was done as a control after neutralizing the antibody with the immunogen used to raise the antibody.
- This antibody has been raised using the following immunogenic sequence: RTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPF. Neuromedin U and Neuromedin S are less than 25% identical, and the sequence mentioned above does not show any similarity with the sequence of Neuromedin U. Therefore, I strongly believe that there should be no cross-reactivity. Generally speaking, I am sure that the product development & quality control teams test the specificity of most of the products using blocking experiments, however, I honestly do not have any such data on my records to share. At the moment we are not selling a peptide specific to this antibody, however, we have another product Neuromedin S Lysate (NBP2-11002) that you can find useful. Several of our customers choose lysates over the peptides for blocking experiments as the lysate contains full length protein and they find it more useful for comparison with their targets being analyzed.
Additional Neuromedin S Products
Blogs on Neuromedin S