Neuromedin S Overexpression Lysate

Images

 
Western Blot: Neuromedin S Overexpression Lysate (Adult Normal) [NBP2-11002] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Neuromedin S.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB

Order Details

Neuromedin S Overexpression Lysate Summary

Description

Neuromedin S Transient Overexpression Lysate


Expression Host: HEK293T

Plasmid: RC223176

Accession#: NM_001011717

Protein Tag: C-MYC/DDK

You will receive 1 vial of lysate (100ug), 1 vial of empty vector negative control (100ug), and 1 vial of 2xSDS sample buffer (250ul). Each vial of cell lysate contains 100ug of total protein (at 1 mg/ml). The 2xSDS Sample Buffer consists of 4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromophenol blue, 100mM DTT.
Gene
NMS

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This product is intended for use as a positive control in Western Blot. Overexpression of the target protein was confirmed using an antibody to DDK (FLAG) epitope tag (NBP1-71705) present on the protein construct.

Each vial of cell lysate contains 100ug of total protein which should be sufficient for 20-50 reactions. Depending on over-expression level, antibody affinity and detection system, some lysates can go as low as 0.1 ug per load. We recommend starting with 5ug of cell lysate. Add an equal amount of cell lysate and 2X SDS Sample buffer and boil the SDS samples for 10 minutes before loading.
Theoretical MW
3.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
RIPA buffer

Lysate Details for Array

Type
Overexpression

Notes

HEK293T cells in 10-cm dishes were transiently transfected with a non-lipid polymer transfection reagent specially designed and manufactured for large volume DNA transfection. Transfected cells were cultured for 48hrs before collection. The cells were lysed in modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4, and then centrifuged to clarify the lysate. Protein concentration was measured by BCA protein assay kit.

Alternate Names for Neuromedin S Overexpression Lysate

  • BCS1L
  • BJS
  • FLGRACILE
  • Neuromedin S
  • neuromedin-S
  • NMS
  • PTD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Lysates are guaranteed for 6 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-02351
Species: Hu, Rt
Applications: EM, IHC, IHC-Fr,  IHC-P, WB
NLS1331
Species: Bt, Bv, Ca, Gp, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC,  IHC-P
NBP1-87452
Species: Hu
Applications: IHC,  IHC-P
NLS396
Species: Hu, Mu
Applications: IHC,  IHC-P
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-46395
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
MAB6378
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-49030
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85630
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, WB

Publications for Neuromedin S Lysate (NBP2-11002) (0)

There are no publications for Neuromedin S Lysate (NBP2-11002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuromedin S Lysate (NBP2-11002) (0)

There are no reviews for Neuromedin S Lysate (NBP2-11002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuromedin S Lysate (NBP2-11002). (Showing 1 - 1 of 1 FAQ).

  1. Could you please let me know NMS antibody cross-reactivity with Neuromedin U? In addition to the query cross-reactivity of Neuromedin S Antibody (NBP1-87515) to Neuromedin U (NMU) whether in the image (imunohistochemistry-Paraffin: Neuromedin S Antibody [NBP1-87515] Immunohistochemical staining of human placenta shows distinct nuclear positivity in trophoblasts), an experiment was done as a control after neutralizing the antibody with the immunogen used to raise the antibody.
    • This antibody has been raised using the following immunogenic sequence: RTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPF. Neuromedin U and Neuromedin S are less than 25% identical, and the sequence mentioned above does not show any similarity with the sequence of Neuromedin U. Therefore, I strongly believe that there should be no cross-reactivity. Generally speaking, I am sure that the product development & quality control teams test the specificity of most of the products using blocking experiments, however, I honestly do not have any such data on my records to share. At the moment we are not selling a peptide specific to this antibody, however, we have another product Neuromedin S Lysate (NBP2-11002) that you can find useful. Several of our customers choose lysates over the peptides for blocking experiments as the lysate contains full length protein and they find it more useful for comparison with their targets being analyzed.

Additional Neuromedin S Products

Blogs on Neuromedin S

There are no specific blogs for Neuromedin S, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuromedin S Overexpression Lysate and receive a gift card or discount.

Bioinformatics

Gene Symbol NMS