Recombinant Human Neurogranin Protein

Images

 
SDS-Page: Recombinant Human Neurogranin Protein [H00004900-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Neurogranin Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 78 of Human NRGN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NRGN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004900-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neurogranin Protein

  • calmodulin-binding protein
  • hng
  • neurogranin (protein kinase C substrate, RC3)
  • Neurogranin
  • Ng
  • NRGN
  • protein kinase C substrate
  • RC3
  • RC3ng

Background

NRGN( AAH02835, 1 a.a. - 79 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Eq, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Eq, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88191
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-858
Species: Hu, Mu, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, In vitro
NBP1-89168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00004900-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Neurogranin Recombinant Protein (H00004900-P01)(1)

Reviews for Neurogranin Recombinant Protein (H00004900-P01) (0)

There are no reviews for Neurogranin Recombinant Protein (H00004900-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurogranin Recombinant Protein (H00004900-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Neurogranin Products

Bioinformatics Tool for Neurogranin Recombinant Protein (H00004900-P01)

Discover related pathways, diseases and genes to Neurogranin Recombinant Protein (H00004900-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurogranin Recombinant Protein (H00004900-P01)

Discover more about diseases related to Neurogranin Recombinant Protein (H00004900-P01).
 

Pathways for Neurogranin Recombinant Protein (H00004900-P01)

View related products by pathway.

PTMs for Neurogranin Recombinant Protein (H00004900-P01)

Learn more about PTMs related to Neurogranin Recombinant Protein (H00004900-P01).
 

Research Areas for Neurogranin Recombinant Protein (H00004900-P01)

Find related products by research area.

Blogs on Neurogranin.

Gut-brain axis: microbiota influence behavior and mental well-being
By Jennifer Sokolowski, MD, PhD.Gut-microbiome interactionsOn and in our bodies, microbes outnumber our cells by about ten-to-one. Studies have revealed that the microbiome influences neurogenesis, cognition, and...  Read full blog post.

Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neurogranin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NRGN
Novus 100% Guarantee