NEURL2 Antibody


Immunohistochemistry-Paraffin: NEURL2 Antibody [NBP2-13654] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

NEURL2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SLPDLVNLGHTWVFAITRHHNRVPREGRPEAEAAAPSRPPTLLVEPYLRI EQFRIPRDRLVGRSRPGLYSHLLDQL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NEURL2 Protein (NBP2-13654PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NEURL2 Antibody

  • C20orf163
  • chromosome 20 open reading frame 163
  • dJ337O18.6
  • FLJ30259
  • MGC125934
  • MGC125935
  • neuralized homolog 2 (Drosophila)
  • neuralized-like 2 (Drosophila)
  • neuralized-like 2
  • neuralized-like protein 2
  • OZZ
  • Ozz-E3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for NEURL2 Antibody (NBP2-13654) (0)

There are no publications for NEURL2 Antibody (NBP2-13654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEURL2 Antibody (NBP2-13654) (0)

There are no reviews for NEURL2 Antibody (NBP2-13654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NEURL2 Antibody (NBP2-13654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NEURL2 Products

Bioinformatics Tool for NEURL2 Antibody (NBP2-13654)

Discover related pathways, diseases and genes to NEURL2 Antibody (NBP2-13654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEURL2 Antibody (NBP2-13654)

Discover more about diseases related to NEURL2 Antibody (NBP2-13654).

Pathways for NEURL2 Antibody (NBP2-13654)

View related products by pathway.

PTMs for NEURL2 Antibody (NBP2-13654)

Learn more about PTMs related to NEURL2 Antibody (NBP2-13654).

Blogs on NEURL2

There are no specific blogs for NEURL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NEURL2 Antibody and receive a gift card or discount.


Gene Symbol NEURL2