NEURL2 Antibody

Immunohistochemistry-Paraffin: NEURL2 Antibody [NBP2-13654] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Discontinued

NEURL2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SLPDLVNLGHTWVFAITRHHNRVPREGRPEAEAAAPSRPPTLLVEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQL
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEURL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NEURL2 Antibody

• C20orf163
• chromosome 20 open reading frame 163
• dJ337O18.6
• FLJ30259
• MGC125934
• MGC125935
• neuralized homolog 2 (Drosophila)
• neuralized-like 2 (Drosophila)
• neuralized-like 2
• neuralized-like protein 2
• OZZ
• Ozz-E3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEURL2