NEURL1B Antibody

Images

 
Western Blot: NEURL1B Antibody [NBP1-90499] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NEURL1B Antibody [NBP1-90499] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: NEURL1B Antibody [NBP1-90499] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEURL1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALIDVYGITDEVQLLESAFADTLTPARLSQARFSACLPPSSHDAANFDNNELENNQVVAKLGHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEURL1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEURL1B Protein (NBP1-90499PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEURL1B Antibody

  • neuralized homolog 1B (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5800
Species: Mu, Rt
Applications: WB, IHC
AF7305
Species: Hu, Mu, Rt
Applications: WB
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
NBP2-20790
Species: Hu, Mu
Applications: WB, ICC/IF
AF1389
Species: Mu
Applications: WB, ICC
NBP1-78446
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-13654
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
MAB72891
Species: Hu
Applications: WB
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-90499
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NEURL1B Antibody (NBP1-90499) (0)

There are no publications for NEURL1B Antibody (NBP1-90499).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEURL1B Antibody (NBP1-90499) (0)

There are no reviews for NEURL1B Antibody (NBP1-90499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEURL1B Antibody (NBP1-90499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEURL1B Products

NEURL1B NBP1-90499

Bioinformatics Tool for NEURL1B Antibody (NBP1-90499)

Discover related pathways, diseases and genes to NEURL1B Antibody (NBP1-90499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEURL1B Antibody (NBP1-90499)

Discover more about diseases related to NEURL1B Antibody (NBP1-90499).

Blogs on NEURL1B

There are no specific blogs for NEURL1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEURL1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEURL1B