Neurabin 1 Recombinant Protein Antigen

Images

 
There are currently no images for Neurabin 1 Recombinant Protein Antigen (NBP2-69010PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Neurabin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Neurabin 1.

Source: E. coli

Amino Acid Sequence: KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP1R9A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-69010.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neurabin 1 Recombinant Protein Antigen

  • KIAA1222NRBI
  • neurabin-1
  • Neurabin-IFLJ20068
  • Neural tissue-specific F-actin-binding protein I
  • NRB1
  • Protein phosphatase 1 regulatory subunit 9A
  • protein phosphatase 1, regulatory (inhibitor) subunit 9A

Background

Neurabin 1 is a brain-specific protein which contains an F-actin binding domain, a PDZ domain, a transmembrane-protein-interacting-domain, and a coiled-coil region. As its structure suggests, Neurabin 1 is a promiscuous protein binding to F-actin, protein phosphatase 1, TGN38, and p70 S6 kinase. Found exclusively in brain, this protein is highly concentrated in the synapse and has also been shown to be enriched in the lamellipodia of the growth cone during neuronal development. Neurabin 1 appears to be a bridging protein by targeting other proteins to the synapse or by linking membrane proteins to the actin cytoskeleton.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF6465
Species: Hu, Rt
Applications: ICC, WB
NBP2-46379
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-81746
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-49643
Species: Bv, Hu, Pm
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, KO, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB5929
Species: Hu, Mu, Rt
Applications: WB
NBP1-89102
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90106
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-45384
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
NBP2-92868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03512
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87299
Species: Hu
Applications: ICC/IF, WB
NB100-1347
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
NBP2-69010PEP
Species: Hu
Applications: AC

Publications for Neurabin 1 Recombinant Protein Antigen (NBP2-69010PEP) (0)

There are no publications for Neurabin 1 Recombinant Protein Antigen (NBP2-69010PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurabin 1 Recombinant Protein Antigen (NBP2-69010PEP) (0)

There are no reviews for Neurabin 1 Recombinant Protein Antigen (NBP2-69010PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neurabin 1 Recombinant Protein Antigen (NBP2-69010PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurabin 1 Products

Research Areas for Neurabin 1 Recombinant Protein Antigen (NBP2-69010PEP)

Find related products by research area.

Blogs on Neurabin 1

There are no specific blogs for Neurabin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neurabin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R9A