Recombinant Human Neurabin 1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Neurabin 1 Protein [H00055607-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Neurabin 1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1090-1188 of Human Neurabin 1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPP1R9A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neurabin 1 GST (N-Term) Protein

  • KIAA1222NRBI
  • neurabin-1
  • Neurabin-IFLJ20068
  • Neural tissue-specific F-actin-binding protein I
  • NRB1
  • Protein phosphatase 1 regulatory subunit 9A
  • protein phosphatase 1, regulatory (inhibitor) subunit 9A

Background

PPP1R9A - protein phosphatase 1, regulatory (inhibitor) subunit 9A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6465
Species: Hu, Rt
Applications: ICC, WB
NBP2-46379
Species: Hu
Applications: IHC, WB
NBP2-81746
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-49643
Species: Bv, Hu, Pm, Mu
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89102
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90105
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45384
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF143
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-92868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03512
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87299
Species: Hu
Applications: ICC/IF, WB
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00055607-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Neurabin 1 Partial Recombinant Protein (H00055607-Q01) (0)

There are no publications for Neurabin 1 Partial Recombinant Protein (H00055607-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurabin 1 Partial Recombinant Protein (H00055607-Q01) (0)

There are no reviews for Neurabin 1 Partial Recombinant Protein (H00055607-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurabin 1 Partial Recombinant Protein (H00055607-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurabin 1 Products

Bioinformatics Tool for Neurabin 1 Partial Recombinant Protein (H00055607-Q01)

Discover related pathways, diseases and genes to Neurabin 1 Partial Recombinant Protein (H00055607-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurabin 1 Partial Recombinant Protein (H00055607-Q01)

Discover more about diseases related to Neurabin 1 Partial Recombinant Protein (H00055607-Q01).
 

Pathways for Neurabin 1 Partial Recombinant Protein (H00055607-Q01)

View related products by pathway.

Research Areas for Neurabin 1 Partial Recombinant Protein (H00055607-Q01)

Find related products by research area.

Blogs on Neurabin 1

There are no specific blogs for Neurabin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neurabin 1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R9A