We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Neudesin Recombinant Protein Antigen

Images

 
There are currently no images for Neudesin Protein (NBP2-13652PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Neudesin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NENF.

Source: E. coli

Amino Acid Sequence: LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NENF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13652.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neudesin Recombinant Protein Antigen

  • Cell immortalization-related protein 2
  • CIR2
  • CIR2cell growth-inhibiting protein 47
  • NENF
  • Neudesin
  • neuron derived neurotrophic factor
  • Neuron-derived neurotrophic factor
  • SCIRP10
  • SCIRP10-related protein
  • Secreted protein of unknown function
  • Spinal cord injury related protein 10
  • SPUF protein
  • SPUF
  • SPUFneudesin

Background

The NENF gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57183
Species: Hu
Applications: ICC/IF, WB
NBP1-71896
Species: Hu
Applications: IP, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47489
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
233-FB
Species: Hu
Applications: BA
DY1747
Species: Hu
Applications: ELISA
NBL1-08472
Species: Hu
Applications: WB
NBP1-52022
Species: Hu
Applications: PEP-ELISA, WB
NBP1-68766
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF4414
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-57578
Species: Hu
Applications: WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-13652PEP
Species: Hu
Applications: AC

Publications for Neudesin Protein (NBP2-13652PEP) (0)

There are no publications for Neudesin Protein (NBP2-13652PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neudesin Protein (NBP2-13652PEP) (0)

There are no reviews for Neudesin Protein (NBP2-13652PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neudesin Protein (NBP2-13652PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neudesin Products

Research Areas for Neudesin Protein (NBP2-13652PEP)

Find related products by research area.

Blogs on Neudesin

There are no specific blogs for Neudesin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neudesin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NENF