NETO2 Antibody

Images

 
Western Blot: NETO2 Antibody [NBP1-62591] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: NETO2 Antibody [NBP1-62591] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NETO2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NETO2(neuropilin (NRP) and tolloid (TLL)-like 2) The peptide sequence was selected from the N terminal of NETO2. Peptide sequence ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NETO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NETO2 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NETO2 Antibody

  • Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 2
  • BTCL2
  • FLJ10430
  • FLJ90456
  • NEOT2
  • NEOT2FLJ14724
  • NETO2
  • neuropilin (NRP) and tolloid (TLL)-like 2
  • neuropilin and tolloid-like protein 2

Background

NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4337
Species: Hu
Applications: WB, IHC, ICC
NBP1-81567
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1397
Species: Hu, Mu, ChHa
Applications: WB, ICC/IF, PEP-ELISA
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-31881
Species: Hu
Applications: IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-57508
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, IHC, IHC-P
NBP2-01625
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85734
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-62591
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC

Publications for NETO2 Antibody (NBP1-62591) (0)

There are no publications for NETO2 Antibody (NBP1-62591).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NETO2 Antibody (NBP1-62591) (0)

There are no reviews for NETO2 Antibody (NBP1-62591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NETO2 Antibody (NBP1-62591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NETO2 Products

Bioinformatics Tool for NETO2 Antibody (NBP1-62591)

Discover related pathways, diseases and genes to NETO2 Antibody (NBP1-62591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NETO2 Antibody (NBP1-62591)

Discover more about diseases related to NETO2 Antibody (NBP1-62591).
 

Pathways for NETO2 Antibody (NBP1-62591)

View related products by pathway.

Blogs on NETO2

There are no specific blogs for NETO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NETO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NETO2
Uniprot