We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Nephronophthisis Recombinant Protein Antigen

Images

 
There are currently no images for Nephronophthisis Protein (NBP2-13672PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nephronophthisis Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NPHP1.

Source: E. coli

Amino Acid Sequence: TVEDTNGSETGFRAWNVQSRGRIFLVSKPVLQINTVDVLTTMGAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NPHP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13672.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nephronophthisis Recombinant Protein Antigen

  • FLJ97602
  • JBTS4NPH1Juvenile nephronophthisis 1 protein
  • nephrocystin 1
  • nephrocystin-1
  • nephronophthisis 1 (juvenile)
  • SLSN1

Background

Nephronophthisis encodes a protein with src homology domain 3 (SH3) patterns. This protein interacts with Crk-associated substrate, and it appears to function in the control of cell division, as well as in cell-cell and cell-matrix adhesion signaling, likely as part of a multifunctional complex localized in actin- and microtubule-based structures. Mutations in this gene cause familial juvenile nephronophthisis type 1, a kidney disorder involving both tubules and glomeruli. Defects in this gene are also associated with Senior-Loken syndrome type 1, also referred to as juvenile nephronophthisis with Leber amaurosis, which is characterized by kidney and eye disease, and with Joubert syndrome type 4, which is characterized by cerebellar ataxia, oculomotor apraxia, psychomotor delay and neonatal breathing abnormalities, sometimes including retinal dystrophy and renal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93637
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
664-LI
Species: Hu
Applications: BA
NBP3-46466
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-47315
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-78206
Species: Hu
Applications: IP, WB
AF5175
Species: Mu
Applications: IHC, Simple Western, WB
NB100-86991
Species: Hu, Mu
Applications: ICC/IF, IP, WB
AF6270
Species: Hu
Applications: ICC
AF5098
Species: Hu, Mu, Rt
Applications: WB
NBP1-06590
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46689
Species: Hu
Applications: ELISA, IHC, IP, WB
NBP1-88691
Species: Hu
Applications: IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for Nephronophthisis Protein (NBP2-13672PEP) (0)

There are no publications for Nephronophthisis Protein (NBP2-13672PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nephronophthisis Protein (NBP2-13672PEP) (0)

There are no reviews for Nephronophthisis Protein (NBP2-13672PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nephronophthisis Protein (NBP2-13672PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nephronophthisis Products

Research Areas for Nephronophthisis Protein (NBP2-13672PEP)

Find related products by research area.

Blogs on Nephronophthisis

There are no specific blogs for Nephronophthisis, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nephronophthisis Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NPHP1