Nephronophthisis Antibody

Images

 
Western Blot: Nephronophthisis Antibody [H00004867-B01P] - Analysis of NPHP1 expression in transfected 293T cell line by NPHP1 polyclonal antibody. Lane 1: NPHP1 transfected lysate(13.31 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nephronophthisis Antibody Summary

Immunogen
NPHP1 (NP_997064.1, 1 a.a. - 121 a.a.) full-length human protein. MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENITEYASFLPFFFLF
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NPHP1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nephronophthisis Antibody

  • FLJ97602
  • JBTS4NPH1Juvenile nephronophthisis 1 protein
  • nephrocystin 1
  • nephrocystin-1
  • nephronophthisis 1 (juvenile)
  • SLSN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39059
Species: Hu
Applications: IHC, IHC-P
H00027130-P02
Species: Hu
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF6270
Species: Hu
Applications: ICC
AF5098
Species: Hu, Mu, Rt
Applications: WB
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Nephronophthisis Antibody (H00004867-B01P) (0)

There are no publications for Nephronophthisis Antibody (H00004867-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nephronophthisis Antibody (H00004867-B01P) (0)

There are no reviews for Nephronophthisis Antibody (H00004867-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nephronophthisis Antibody (H00004867-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nephronophthisis Products

Bioinformatics Tool for Nephronophthisis Antibody (H00004867-B01P)

Discover related pathways, diseases and genes to Nephronophthisis Antibody (H00004867-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nephronophthisis Antibody (H00004867-B01P)

Discover more about diseases related to Nephronophthisis Antibody (H00004867-B01P).
 

Pathways for Nephronophthisis Antibody (H00004867-B01P)

View related products by pathway.

PTMs for Nephronophthisis Antibody (H00004867-B01P)

Learn more about PTMs related to Nephronophthisis Antibody (H00004867-B01P).

Blogs on Nephronophthisis

There are no specific blogs for Nephronophthisis, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nephronophthisis Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPHP1
Uniprot