nef-associated protein 1 Antibody

Images

 
Western Blot: nef-associated protein 1 Antibody [NBP2-14424] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-378
Immunohistochemistry-Paraffin: nef-associated protein 1 Antibody [NBP2-14424] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

nef-associated protein 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEA VLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRIKPASEPV HMTGPVGSLVSLGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C9ORF156
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
nef-associated protein 1 Protein (NBP2-14424PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for nef-associated protein 1 Antibody

  • C9orf156
  • chromosome 9 open reading frame 156
  • EC 3.1.2.-
  • HSPC219
  • NAP1
  • NAP1Nef associated protein 1
  • Nef (lentivirus myristoylated factor) associated protein 1
  • nef-associated protein 1
  • RP11-23B15.3
  • Thioesterase NAP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-57026
Species: Hu
Applications: ICC/IF
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-36543
Species: Hu
Applications: WB, IP
NBP2-57502
Species: Hu
Applications: ICC/IF
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P

Publications for nef-associated protein 1 Antibody (NBP2-14424) (0)

There are no publications for nef-associated protein 1 Antibody (NBP2-14424).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for nef-associated protein 1 Antibody (NBP2-14424) (0)

There are no reviews for nef-associated protein 1 Antibody (NBP2-14424). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for nef-associated protein 1 Antibody (NBP2-14424) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional nef-associated protein 1 Products

Bioinformatics Tool for nef-associated protein 1 Antibody (NBP2-14424)

Discover related pathways, diseases and genes to nef-associated protein 1 Antibody (NBP2-14424). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for nef-associated protein 1 Antibody (NBP2-14424)

Discover more about diseases related to nef-associated protein 1 Antibody (NBP2-14424).
 

Pathways for nef-associated protein 1 Antibody (NBP2-14424)

View related products by pathway.

PTMs for nef-associated protein 1 Antibody (NBP2-14424)

Learn more about PTMs related to nef-associated protein 1 Antibody (NBP2-14424).

Blogs on nef-associated protein 1

There are no specific blogs for nef-associated protein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our nef-associated protein 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C9ORF156