Recombinant Human NEDL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NEDL2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 637-745 of Human HECW2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HECW2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NEDL2 Protein

  • C2 and WW domain-containing protein 2
  • DKFZp686M17164
  • EC 6.3.2
  • EC 6.3.2.-
  • HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
  • NEDD4-like E3 ubiquitin-protein ligase 2

Background

HECW2 - HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00063891-M01
Species: Hu
Applications: WB, ELISA
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48690
Species: Hu
Applications: WB, IHC
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-43538
Species: Hu
Applications: WB, IHC, IHC-P
NB300-203
Species: Hu, Mu, Rt(-)
Applications: WB, ChIP, ICC/IF, IHC-P, IP
NBP1-84754
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-12899
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-79495
Species: Hu
Applications: WB
AF6270
Species: Hu
Applications: ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56695
Species: Hu
Applications: WB
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NEDL2 Partial Recombinant Protein (H00057520-Q01) (0)

There are no publications for NEDL2 Partial Recombinant Protein (H00057520-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDL2 Partial Recombinant Protein (H00057520-Q01) (0)

There are no reviews for NEDL2 Partial Recombinant Protein (H00057520-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEDL2 Partial Recombinant Protein (H00057520-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NEDL2 Products

Bioinformatics Tool for NEDL2 Partial Recombinant Protein (H00057520-Q01)

Discover related pathways, diseases and genes to NEDL2 Partial Recombinant Protein (H00057520-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDL2 Partial Recombinant Protein (H00057520-Q01)

Discover more about diseases related to NEDL2 Partial Recombinant Protein (H00057520-Q01).
 

Pathways for NEDL2 Partial Recombinant Protein (H00057520-Q01)

View related products by pathway.

PTMs for NEDL2 Partial Recombinant Protein (H00057520-Q01)

Learn more about PTMs related to NEDL2 Partial Recombinant Protein (H00057520-Q01).

Blogs on NEDL2

There are no specific blogs for NEDL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NEDL2 Antibody
NBP1-92174

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NEDL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HECW2