Home » NDUFV3 » NDUFV3 Antibodies » NDUFV3 Antibody

NDUFV3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NDUFV3 Antibody [H00004731-D01P] - Analysis of NDUFV3 expression in transfected 293T cell line by NDUFV3 polyclonal antibody.Lane 1: NDUFV3 transfected lysate(11.90 KDa).Lane 2: Non-transfected lysate.
Western Blot: NDUFV3 Antibody [H00004731-D01P] - Analysis of NDUFV3 expression in transfected 293T cell line by NDUFV3 polyclonal antibody.Lane 1: NDUFV3 transfected lysate(11.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NDUFV3 Antibody Summary

Immunogen
NDUFV3 (NP_001001503.1, 1 a.a. - 108 a.a.) full-length human protein. MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
Specificity
NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFV3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against mammalian transfected lysate in WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFV3 Antibody

  • CI-10k
  • CI-9KD
  • complex I 10kDa subunit
  • complex I, mitochondrial respiratory chain, 10-kD subunit
  • Complex I-9kD
  • mitochondrial NADH oxidoreductase-like protein
  • NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
  • NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
  • NADH-ubiquinone oxidoreductase 9 kD subunit precursor, EC 1.6.5.310CI-9kD
  • NADH-ubiquinone oxidoreductase 9 kD subunit
  • NADH-ubiquinone oxidoreductase 9 kDa subunit
  • NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD
  • Renal carcinoma antigen NY-REN-4

Background

The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

WDR4 Antibody
NBP2-20893
Western Blot: WDR4 Antibody [NBP2-20893] - Sample (30 ug of whole cell lysate) A: A549 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: WDR4 Antibody [NBP2-20893] - Immunohistochemical analysis of paraffin-embedded NCIN87 xenograft, using antibody at 1:500 dilution.
Immunocytochemistry/Immunofluorescence: WDR4 Antibody [NBP2-20893] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:500 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PKNOX1 Antibody
NBP2-19853
Western Blot: PKNOX1 Antibody [NBP2-19853] - HepG2 whole cell and nuclear extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PKNOX1 antibody diluted at 1:2000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PKNOX1 Antibody [NBP2-19853] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: PKNOX1 protein stained by PKNOX1 antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
(1 Publication)
Species: Hu
Applications: ChIP, ICC/IF, IP, WB
ABCG1 Antibody -
BSA Free
NB400-132
Flow (Intracellular): ABCG1 Antibody [NB400-132] - RAW 246.7 cells were either untreated (A) or serum starved for 24 hours, and then treated with 1uM TO9 for 24 hours (B). An intracellular stain was performed with NB400-132 (blue) and a matched isotype control NB810-56910 (orange). Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Goat Anti-Rabbit Dylight 550-conjugated antibody.
Immunohistochemistry-Paraffin: ABCG1 Antibody [NB400-132] - Staining of human lung, alveolar macrophages.
Western Blot: ABCG1 Antibody [NB400-132] - SAA has little impact on the impairment in biliary and fecal excretion of macrophage-derived 3H-cholesterol during endotoxemia. WT and SAAKO mice were injected subcutaneously with PBS or 0.8 ug/g LPS as indicated, followed 4 hr later by intraperitoneal injection of 3H-cholesterol-labeled J774 macrophages. ABCG1 in liver lysates (40 ug protein) was identified by immunoblotting and quantified by densitometry. Results from each of the 3 experiments (n = 4-5 per group per experiment) were expressed relative to PBS-injected WT mice after normalization to beta-actin. A representative western blot is shown. Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/jl/2013/283486/), licensed under a CC-BY licence.
(2 Reviews)
(164 Publications)
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, IP, In vitro, WB
PDE9A Antibody -
BSA Free
NBP1-00641
Western Blot: PDE9A Antibody [NBP1-00641] - WB analysis of PDE9A in HeLa whole cell lysate.
Immunocytochemistry/Immunofluorescence: PDE9A Antibody [NBP1-00641] - PDE9A antibody was tested in NIH/3T3 cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: PDE9A Antibody [NBP1-00641] - PDE9A antibody was tested in mouse prostate using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-87964
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Epididymis shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Kidney shows strong membranous and cytoplasmic positivity in cells in tubules and glomeruli.
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Rectum shows strong membranous and cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Peripherin 2/PRPH2
Antibody
NBP1-86687
Western Blot: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Analysis in control (vector only transfected HEK293T lysate) and PRPH2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P, WB
Myoglobin Antibody
G-125-C
Myoglobin Antibody
Species: Hu
Applications:
ATP7b Antibody -
BSA Free
NB100-360
Immunocytochemistry/Immunofluorescence: ATP7b Antibody [NB100-360] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-ATP7b [NB100-360] at a 1:100 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at 1:500. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: ATP7b Antibody [NB100-360] - ATP7b detected in 20 ug of mouse brain membrane fraction.
Immunohistochemistry: ATP7b Antibody [NB100-360] - Analysis of ATP7b in mouse liver using DAB with hematoxylin counterstain.
(1 Review)
(17 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
CBS Antibody (3E1)
H00000875-M01
Western Blot: CBS Antibody (3E1) [H00000875-M01] - Analysis of CBS expression in transfected 293T cell line by CBS monoclonal antibody (M01), clone 3E1.Lane 1: CBS transfected lysate(61 KDa).Lane 2: Non-transfected lysate.
ELISA: CBS Antibody (3E1) [H00000875-M01] - Detection limit for recombinant GST tagged CBS is approximately 0.1ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: CBS Antibody (3E1) [H00000875-M01] - Analysis of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human hepatocellular carcinoma. Antibody concentration 3 ug/ml.
(1 Review)
(48 Publications)
Species: Ba, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
DHPS Antibody
NBP1-82648
Immunocytochemistry/Immunofluorescence: DHPS Antibody [NBP1-82648] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Western Blot: DHPS Antibody [NBP1-82648] - Analysis in control (vector only transfected HEK293T lysate) and DHPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Band 3 Antibody
NBP2-49409
Immunohistochemistry: Band 3 Antibody [NBP2-49409] - Staining of human spleen shows strong positivity in erythrocytes.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP2-49409] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP2-49409] - Staining in human bone marrow and cerebral cortex tissues using anti-SLC4A1 antibody. Corresponding SLC4A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
NDUFV3 Antibody
H00004731-D01P
NDUFV3 Antibody
Species: Hu
Applications: WB

Publications for NDUFV3 Antibody (H00004731-D01P) (0)

There are no publications for NDUFV3 Antibody (H00004731-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFV3 Antibody (H00004731-D01P) (0)

There are no reviews for NDUFV3 Antibody (H00004731-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFV3 Antibody (H00004731-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFV3 Products

Bioinformatics Tool for NDUFV3 Antibody (H00004731-D01P)

Discover related pathways, diseases and genes to NDUFV3 Antibody (H00004731-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV3 Antibody (H00004731-D01P)

Discover more about diseases related to NDUFV3 Antibody (H00004731-D01P).

Research Areas for NDUFV3 Antibody (H00004731-D01P)

Find related products by research area.

Blogs on NDUFV3

There are no specific blogs for NDUFV3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFV3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NDUFV3
Entrez
Uniprot