NDUFV3 Antibody

Images

 
Western Blot: NDUFV3 Antibody [H00004731-D01P] - Analysis of NDUFV3 expression in transfected 293T cell line by NDUFV3 polyclonal antibody.Lane 1: NDUFV3 transfected lysate(11.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFV3 Antibody Summary

Immunogen
NDUFV3 (NP_001001503.1, 1 a.a. - 108 a.a.) full-length human protein. MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
Specificity
NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFV3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against mammalian transfected lysate in WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFV3 Antibody

  • CI-10k
  • CI-9KD
  • complex I 10kDa subunit
  • complex I, mitochondrial respiratory chain, 10-kD subunit
  • Complex I-9kD
  • mitochondrial NADH oxidoreductase-like protein
  • NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
  • NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
  • NADH-ubiquinone oxidoreductase 9 kD subunit precursor, EC 1.6.5.310CI-9kD
  • NADH-ubiquinone oxidoreductase 9 kD subunit
  • NADH-ubiquinone oxidoreductase 9 kDa subunit
  • NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD
  • Renal carcinoma antigen NY-REN-4

Background

The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20893
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19853
Species: Hu
Applications: ChIP, ICC/IF, IP, WB
NB400-132
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, IP, In vitro, WB
NBP1-00641
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87964
Species: Hu
Applications: IHC, IHC-P
NBP1-86687
Species: Hu
Applications: IHC, IHC-P, WB
G-125-C
Species: Hu
Applications:
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
H00000875-M01
Species: Ba, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
H00004731-D01P
Species: Hu
Applications: WB

Publications for NDUFV3 Antibody (H00004731-D01P) (0)

There are no publications for NDUFV3 Antibody (H00004731-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFV3 Antibody (H00004731-D01P) (0)

There are no reviews for NDUFV3 Antibody (H00004731-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFV3 Antibody (H00004731-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFV3 Products

Bioinformatics Tool for NDUFV3 Antibody (H00004731-D01P)

Discover related pathways, diseases and genes to NDUFV3 Antibody (H00004731-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV3 Antibody (H00004731-D01P)

Discover more about diseases related to NDUFV3 Antibody (H00004731-D01P).

Research Areas for NDUFV3 Antibody (H00004731-D01P)

Find related products by research area.

Blogs on NDUFV3

There are no specific blogs for NDUFV3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFV3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFV3
Entrez
Uniprot