NDUFV3 Antibody - Azide and BSA Free

Western Blot: NDUFV3 Antibody [H00004731-D01P] - Analysis of NDUFV3 expression in transfected 293T cell line by NDUFV3 polyclonal antibody.Lane 1: NDUFV3 transfected lysate(11.90 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDUFV3 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NDUFV3 (NP_001001503.1, 1 a.a. - 108 a.a.) full-length human protein. MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
• Specificity: NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFV3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against mammalian transfected lysate in WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFV3 Antibody - Azide and BSA Free

• CI-10k
• CI-9KD
• complex I 10kDa subunit
• complex I, mitochondrial respiratory chain, 10-kD subunit
• Complex I-9kD
• mitochondrial NADH oxidoreductase-like protein
• NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD)
• NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
• NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
• NADH-ubiquinone oxidoreductase 9 kD subunit precursor, EC 1.6.5.310CI-9kD
• NADH-ubiquinone oxidoreductase 9 kD subunit
• NADH-ubiquinone oxidoreductase 9 kDa subunit
• NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD
• Renal carcinoma antigen NY-REN-4

Background

The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFV3
• Entrez:
  • 4731(Human)
• Uniprot:
  • NP_001001503.1(Human)