NDUFB2 Recombinant Protein Antigen

Images

 
There are currently no images for NDUFB2 Protein (NBP2-31908PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NDUFB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDUFB2.

Source: E. coli

Amino Acid Sequence: QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NDUFB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31908.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NDUFB2 Recombinant Protein Antigen

  • CI-AGGGmitochondrial
  • MGC70788
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2 (8kD, AGGG)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa

Background

The protein encoded by the NDUFB2 gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

2428-FC
Species: Hu
Applications: Bind
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
1310-SE
Species: Hu
Applications: EnzAct
DY421
Species: Mu
Applications: ELISA
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
DCDL40
Species: Hu
Applications: ELISA
DY1335B
Species: Hu
Applications: ELISA
NBP1-33607
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP1-87315
Species: Hu
Applications: IHC,  IHC-P
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00005355-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-81734
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-76657
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for NDUFB2 Protein (NBP2-31908PEP) (0)

There are no publications for NDUFB2 Protein (NBP2-31908PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB2 Protein (NBP2-31908PEP) (0)

There are no reviews for NDUFB2 Protein (NBP2-31908PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NDUFB2 Protein (NBP2-31908PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFB2 Products

Research Areas for NDUFB2 Protein (NBP2-31908PEP)

Find related products by research area.

Blogs on NDUFB2

There are no specific blogs for NDUFB2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NDUFB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB2