NDUFAF4 Antibody - BSA Free

Staining of human cell line U2OS shows localization to cytosol & mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFAF4 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein NDUFAF4 using the following amino acid sequence: IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFAF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDUFAF4 Antibody - BSA Free

• bA22L21.1
• C6orf66chromosome 6 open reading frame 66
• Hormone-regulated proliferation-associated protein of 20 kDa
• hormone-regulated proliferation-associated protein, 20 kDa
• HRPAP20HSPC125
• My013
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4

Background

NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene are a cause of mitochondrial complex I deficiency. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFAF4