Recombinant Human NDST3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NDST3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 162-259 of Human NDST3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH

Protein/Peptide Type
Partial Recombinant Protein
Gene
NDST3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDST3 Protein

  • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3
  • EC 2.8.2.8
  • GlcNAc N-deacetylase/ N-sulfotransferase 3
  • Glucosaminyl N-deacetylase/N-sulfotransferase 3
  • hNDST-3
  • HSST3MGC130028
  • MGC130029
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3
  • NDST-3
  • N-heparan sulfate sulfotransferase 3
  • N-HSST 3

Background

NDST3 - N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13645
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP1-86481
Species: Hu
Applications: IHC, IHC-P
NBP1-92415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5057
Species: Hu
Applications: WB
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001325-P01
Species: Hu
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBL1-16115
Species: Hu

Publications for NDST3 Partial Recombinant Protein (H00009348-Q01) (0)

There are no publications for NDST3 Partial Recombinant Protein (H00009348-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDST3 Partial Recombinant Protein (H00009348-Q01) (0)

There are no reviews for NDST3 Partial Recombinant Protein (H00009348-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDST3 Partial Recombinant Protein (H00009348-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDST3 Products

Bioinformatics Tool for NDST3 Partial Recombinant Protein (H00009348-Q01)

Discover related pathways, diseases and genes to NDST3 Partial Recombinant Protein (H00009348-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDST3 Partial Recombinant Protein (H00009348-Q01)

Discover more about diseases related to NDST3 Partial Recombinant Protein (H00009348-Q01).
 

Pathways for NDST3 Partial Recombinant Protein (H00009348-Q01)

View related products by pathway.

PTMs for NDST3 Partial Recombinant Protein (H00009348-Q01)

Learn more about PTMs related to NDST3 Partial Recombinant Protein (H00009348-Q01).

Blogs on NDST3

There are no specific blogs for NDST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NDST3 Antibody
NBP2-49216

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDST3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDST3