NCOA5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NCOA5 Antibody [NBP2-47361] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & actin filaments.

Immunohistochemistry-Paraffin: NCOA5 Antibody [NBP2-47361] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Western Blot: NCOA5 Antibody [NBP2-47361] -Analysis in human cell line SCLC-21H.

Immunohistochemistry-Paraffin: NCOA5 Antibody [NBP2-47361] -Staining of human pancreas shows moderate nuclear positivity in islets of Langerhans and exocrine cells.

Immunohistochemistry-Paraffin: NCOA5 Antibody [NBP2-47361] -Staining of human rectum shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: NCOA5 Antibody [NBP2-47361] -Staining of human kidney shows moderate nuclear positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NCOA5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NCOA5 Antibody - BSA Free (NBP2-47361) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPL
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCOA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NCOA5 Protein (NBP2-47361PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NCOA5 Antibody - BSA Free

• CIAbA465L10.6
• Coactivator independent of AF-2
• KIAA1637
• NCoA-5
• nuclear receptor coactivator 5

Background

NCOA5 is a nuclear receptor coregulator that can have both coactivator and corepressor functions. It interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF-2) of the ESR receptors, and with the orphan nuclear receptor NR1D2. It Is also involved in the coactivation of nuclear steroid receptors (ER) as well as the corepression of MYC/c-myc in response to 17-beta-estradiol (E2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCOA5