Recombinant Human Natriuretic Peptide Receptor C Protein

Images

 
SDS-Page: Recombinant Human Natriuretic Peptide Receptor C Protein [H00004883-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Natriuretic Peptide Receptor C Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 42 - 140 of Human NPR3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA

Protein/Peptide Type
Partial Recombinant Protein
Gene
NPR3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Natriuretic Peptide Receptor C Protein

  • ANP-C
  • ANPR-C
  • ANPRCFLJ14054
  • Atrial natriuretic peptide clearance receptor
  • atrial natriuretic peptide receptor 3
  • Atrial natriuretic peptide receptor type C
  • C5orf23
  • chromosome 5 open reading frame 23
  • GUCY2B
  • lgj
  • natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptidereceptor C)
  • NPR3
  • NPRC
  • NPR-C
  • stri

Background

NPR3 - natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
AF4414
Species: Hu
Applications: WB, IHC
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004883-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01) (0)

There are no publications for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01) (0)

There are no reviews for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Natriuretic Peptide Receptor C Products

Bioinformatics Tool for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01)

Discover related pathways, diseases and genes to Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01)

Discover more about diseases related to Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01).
 

Pathways for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01)

View related products by pathway.

PTMs for Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01)

Learn more about PTMs related to Natriuretic Peptide Receptor C Partial Recombinant Protein (H00004883-Q01).

Blogs on Natriuretic Peptide Receptor C

There are no specific blogs for Natriuretic Peptide Receptor C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605
Desmin Antibody
NB120-15200-0.1ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Natriuretic Peptide Receptor C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPR3
Entrez