Natriuretic Peptide Receptor C Antibody

Images

 
Western Blot: Natriuretic Peptide Receptor C Antibody [NBP1-90163] - Analysis in human cell line HeLa and human cell line CACO-2.
Immunohistochemistry-Paraffin: Natriuretic Peptide Receptor C Antibody [NBP1-90163] - Staining of human fallopian tube shows moderate to strong membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Natriuretic Peptide Receptor C Antibody [NBP1-90163] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Natriuretic Peptide Receptor C Antibody [NBP1-90163] - Staining of human kidney shows moderate to strong membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Natriuretic Peptide Receptor C Antibody [NBP1-90163] - Staining of human endometrium shows moderate to strong membranous positivity in smooth muscle cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Natriuretic Peptide Receptor C Antibody [NBP1-90163] - Staining in human kidney and cerebral cortex tissues.. Corresponding NPR3 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Natriuretic Peptide Receptor C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSW
Specificity
Specificity of human Natriuretic Peptide Receptor C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Natriuretic Peptide Receptor C Protein (NBP1-90163PEP)
Publications
Read Publication using NBP1-90163.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22134537)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Natriuretic Peptide Receptor C Antibody

  • ANP-C
  • ANPR-C
  • ANPRCFLJ14054
  • Atrial natriuretic peptide clearance receptor
  • atrial natriuretic peptide receptor 3
  • Atrial natriuretic peptide receptor type C
  • C5orf23
  • chromosome 5 open reading frame 23
  • GUCY2B
  • lgj
  • natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptidereceptor C)
  • NPR3
  • NPRC
  • NPR-C
  • stri

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31333
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
H00004882-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA, ELISA(Cap)
NBP2-46635
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP2-46201
Species: Hu
Applications: WB, IHC
AF4414
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
H00010641-B01P
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-90163
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Natriuretic Peptide Receptor C Antibody (NBP1-90163)(1)


Reviews for Natriuretic Peptide Receptor C Antibody (NBP1-90163) (0)

There are no reviews for Natriuretic Peptide Receptor C Antibody (NBP1-90163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Natriuretic Peptide Receptor C Antibody (NBP1-90163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Natriuretic Peptide Receptor C Products

Bioinformatics Tool for Natriuretic Peptide Receptor C Antibody (NBP1-90163)

Discover related pathways, diseases and genes to Natriuretic Peptide Receptor C Antibody (NBP1-90163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Natriuretic Peptide Receptor C Antibody (NBP1-90163)

Discover more about diseases related to Natriuretic Peptide Receptor C Antibody (NBP1-90163).
 

Pathways for Natriuretic Peptide Receptor C Antibody (NBP1-90163)

View related products by pathway.

PTMs for Natriuretic Peptide Receptor C Antibody (NBP1-90163)

Learn more about PTMs related to Natriuretic Peptide Receptor C Antibody (NBP1-90163).

Blogs on Natriuretic Peptide Receptor C

There are no specific blogs for Natriuretic Peptide Receptor C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Natriuretic Peptide Receptor C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPR3