Natriuretic Peptide Receptor C Antibody

Images

 
Immunohistochemistry: Natriuretic Peptide Receptor C Antibody [NBP1-90163] - Staining of human testis shows strong cytoplasmic positivity in leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Natriuretic Peptide Receptor C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Natriuretic Peptide Receptor C Protein (NBP1-90163PEP)
Publications
Read Publication using NBP1-90163.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22134537)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Natriuretic Peptide Receptor C Antibody

  • ANP-C
  • ANPR-C
  • ANPRCFLJ14054
  • Atrial natriuretic peptide clearance receptor
  • atrial natriuretic peptide receptor 3
  • Atrial natriuretic peptide receptor type C
  • C5orf23
  • chromosome 5 open reading frame 23
  • GUCY2B
  • lgj
  • natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptidereceptor C)
  • NPR3
  • NPRC
  • NPR-C
  • stri

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
AF4414
Species: Hu
Applications: WB, IHC
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90163
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Natriuretic Peptide Receptor C Antibody (NBP1-90163)(1)


Reviews for Natriuretic Peptide Receptor C Antibody (NBP1-90163) (0)

There are no reviews for Natriuretic Peptide Receptor C Antibody (NBP1-90163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Natriuretic Peptide Receptor C Antibody (NBP1-90163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Natriuretic Peptide Receptor C Products

Bioinformatics Tool for Natriuretic Peptide Receptor C Antibody (NBP1-90163)

Discover related pathways, diseases and genes to Natriuretic Peptide Receptor C Antibody (NBP1-90163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Natriuretic Peptide Receptor C Antibody (NBP1-90163)

Discover more about diseases related to Natriuretic Peptide Receptor C Antibody (NBP1-90163).
 

Pathways for Natriuretic Peptide Receptor C Antibody (NBP1-90163)

View related products by pathway.

PTMs for Natriuretic Peptide Receptor C Antibody (NBP1-90163)

Learn more about PTMs related to Natriuretic Peptide Receptor C Antibody (NBP1-90163).

Blogs on Natriuretic Peptide Receptor C

There are no specific blogs for Natriuretic Peptide Receptor C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Natriuretic Peptide Receptor C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPR3
Entrez